Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79288_AD11.jpg Application Data (Fig. 3: Confluent PAE/KDR cells were stimulated with 50ng/ml human VEGF165 for 10 min at 37°C. Cells were lysed and an IP was performed using a mouse anti-human KDR antibody (Cat# WB was performed with a mouse anti-human KDR antibody (Cat# and an anti- Phosphotyrosine antibody.)

VEGF165 active protein

Human VEGF165

Average rating 0.0
No ratings yet
Gene Names
VEGFA; VPF; VEGF; MVCD1
Reactivity
Human
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
VEGF165; N/A; Human VEGF165; VEGF-A; VPF; VEGF165 active protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Sterile filtered protein solution was lyophilized from 50 mM acetic acid, free from stabilizers and preservatives.
Sequence Positions
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Sequence
N-Terminal Sequence: APMAEGG
Sequence Length
165
Amino Acids
165 aa
Reconstitution
The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 ug/ml. Store at 2°C to 8°C for up to 1 week or prepare for extended storage.
Buffer
50 mM acetic acid
Preparation and Storage
After initial reconstitution, the addition of at least 0.1% human or bovine serum albumin is recommended for frozen aliquots. Prepare and store working aliquots at -20°C to -80°C.
Product Form Temperature Storage Time
Lyophilized -20°C to -80°C 1 year
Lyophilized 2°C to 8°C 6 months
Lyophilized Room Temperature 1 month
Extended Storage -20°C to -80°C 3 months

Application Data

(Fig. 3: Confluent PAE/KDR cells were stimulated with 50ng/ml human VEGF165 for 10 min at 37°C. Cells were lysed and an IP was performed using a mouse anti-human KDR antibody (Cat# WB was performed with a mouse anti-human KDR antibody (Cat# and an anti- Phosphotyrosine antibody.)

product-image-AAA79288_AD11.jpg Application Data (Fig. 3: Confluent PAE/KDR cells were stimulated with 50ng/ml human VEGF165 for 10 min at 37°C. Cells were lysed and an IP was performed using a mouse anti-human KDR antibody (Cat# WB was performed with a mouse anti-human KDR antibody (Cat# and an anti- Phosphotyrosine antibody.)

Application Data

product-image-AAA79288_AD13.jpg Application Data

Application Data

product-image-AAA79288_AD15.jpg Application Data
Related Product Information for VEGF165 active protein
Human Vascular Endothelial Growth Factor VEGF165, a 23 kDa protein consisting of 165 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR). Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extra villous trophoblast. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemo attractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homo-dimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.
Product Categories/Family for VEGF165 active protein
References
1. Breier et al., Dev 114:521, 1992 2. Fiebig et al., Eur J Biochem 211:19, 1993 3. Flamme et al., Dev Biol 162:699, 1995 4. Kremer at al., Cancer Res 57:3852, 1997

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,2 kDa
NCBI Official Full Name
vascular endothelial growth factor A isoform a
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VEGF165 vegfa (Catalog #AAA79288) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR. The Human VEGF165 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: N-Terminal Sequence: APMAEGG. It is sometimes possible for the material contained within the vial of "VEGF165, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.