VEGF206 active protein

Human VEGF206

Cat. Num. AAA14948

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Reactivity: Human
• Purity: >=75% by SDS-PAGE & Coomasie stain
• Synonyms: VEGF206; N/A; Human VEGF206; VEGF-A, VPF; VEGF206 active protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: >=75% by SDS-PAGE & Coomasie stain
• Form/Format: Lyophilized
• Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Sequence Length: 206

• Gene: vegf
• Reconstitution: Centrifuge vial prior to opening.; The lyophilized VEGF₂₀₆ should be reconstituted in 50mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Biological Activity: The ED₅₀for stimulation of cell proliferation in human dermal lymphatic endothelial cells (HDLEC) by VEGF₂₀₆ has been determined to be in the range of 5-15 ng/ml.
• Stabilizer: None
• Result by N-terminal sequencing: APMAEGG
• Buffer: 50 mM acetic acid
• Length (aa): 206
• Preparation and Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted VEGF206 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.

Application Data

SDS-PAGE

Related Product Information for VEGF206 active protein

Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206. VEGF121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF189 or VEGF206, are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF165 has intermediate properties. VEGF165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF189 or VEGF206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF189 or VEGF2O6 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF189 and VEGF206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity, the affinity of VEGF206 is much weaker. All dimeric forms have similar biological activities but their bioavailability is very different. However so far there are only a few data about the biological activities of VEGF206.

Product Categories/Family for VEGF206 active protein

Cytokines & Growth Factors

References

1. Park JE et al, Mol Biol Cell 4:1317, 1993 2. Grützkau A et al, Mol Biol Cell 9:875, 1998 3. Breier et al., Dev 114:521, 1992 4. Fiebig et al., Eur J Biochem 211:19, 1993 5. Flamme et al., Dev Biol 162:699, 1995 6. Kremer at al., Cancer Res 57:3852, 1997

NCBI and Uniprot Product Information

• NCBI GI #: 76781480
• NCBI GeneID: 7422
• NCBI Accession #: NP_001165095
• NCBI GenBank Nucleotide #: NM_001171624
• UniProt Accession #: P15692-1; O60720; O75875; Q074Z4; Q16889; Q5UB46; Q6P0P5; Q96KJ0; Q96L82; Q96NW5; Q9H1W8; B5BU86; P15692
• Molecular Weight: ~47 kDa (Dimer)
• NCBI Official Full Name: vascular endothelial growth factor A isoform a
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A; vascular permeability factor
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN