Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14944_APP2.jpg Application Data (Proliferation assay with TF-I cells.)

SCF active protein

Mouse SCF

Gene Names
Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
SCF; N/A; Mouse SCF; Recombinant Mouse Stem Cell Factor (SCF); Hematopoietic growth factor KL; c-Kit ligand; SCF active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQ LSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPK RPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT KPFMLPPVA
Sequence Length
165
Endotoxin Level
< 0.1ng/ug of mSCF
Length (aa)
165
Biological Activity
The ED50 as determined by the dose-depend stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml.
Buffer
0.5X PBS
Gene
Kitlg
Reconstitution
Mouse SCF should be reconstituted in 50mM acetis acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20 degree C.
Preparation and Storage
The lyophilized mouse SCF is best stored desiccated below 0 degree C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles.

Application Data

(Proliferation assay with TF-I cells.)

product-image-AAA14944_APP2.jpg Application Data (Proliferation assay with TF-I cells.)

Application Data

product-image-AAA14944_APP.jpg Application Data
Related Product Information for SCF active protein
Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.
Product Categories/Family for SCF active protein
References
1. Ashman LK Int J Biochem Cell Biol 31 (1999) 2. Sette et al, Int J Dev Biol 44 (2000) 5. Kapur et al, Blood 100 (2002) 6. Wang et al, Arterioscler Thromb Vasc Biol 27 (2007) 7. Bashamboo et al, J Cell Sci 119 (2006) 10. Arakawa et al, J Biol Chem 266 (1991) 13. Flanagan et al, Cell 64 (1991) 14. Martin et al, Cell 63 (1990) 15. Lemmon et al, J Biol Chem 272 (1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.42 kDa
NCBI Official Full Name
kit ligand
NCBI Official Synonym Full Names
kit ligand
NCBI Official Symbol
Kitl
NCBI Official Synonym Symbols
Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
NCBI Protein Information
kit ligand; cloud gray; C-kit ligand; Steel factor; grizzle-belly; stem cell factor; mast cell growth factor; hematopoietic growth factor KL
UniProt Protein Name
Kit ligand
UniProt Gene Name
Kitlg
UniProt Synonym Gene Names
Kitl; Mgf; Sl; Slf; MGF; SCF; sKITLG
UniProt Entry Name
SCF_MOUSE

Similar Products

Product Notes

The SCF kitlg (Catalog #AAA14944) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Mouse SCF reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MKEICGNPVT DNVKDITKLV ANLPNDYMIT LNYVAGMDVL PSHCWLRDMV IQ LSLSLTTLLD KFSNISEGLS NYSIIDKLGK IVDDLVLCME ENAPKNIKES PK RPETRSFTPE EFFSIFNRSI DAFKDFMVAS DTSDCVLSST LGPEKDSRVS VT KPFMLPPVA. It is sometimes possible for the material contained within the vial of "SCF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.