Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79301_AD13.jpg Application Data

CNTF active protein

Rat CNTF

Average rating 0.0
No ratings yet
Reactivity
Rat
Purity
> 98% by SDS-PAGE & silver stain
Synonyms
CNTF; N/A; Rat CNTF; Recombinant Rat Ciliary Neurotrophic Factor (CNTF); Ciliary Neurotrophic Factor; CNTF active protein
Ordering
Host
E Coli
Reactivity
Rat
Purity/Purification
> 98% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Sequence Length
199
Endotoxin Level
< 0.1ng per ug of CNTF
Buffer
5 mM sodium acetate, pH 6.5
Preparation and Storage
The lyophilized powder although stable at room temperature for 3 weeks, is best stored desiccated at -20 degree C. Reconstituted rat CNTF should be stored in working aliquots at -20 degree C. For long term storage it is recommended to add a carrier protein (0.1% HAS or BSA).

Application Data

product-image-AAA79301_AD13.jpg Application Data

Application Data

product-image-AAA79301_AD15.jpg Application Data
Related Product Information for CNTF active protein
Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2 -Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.
Product Categories/Family for CNTF active protein
References
1. Finn T and Nishi R, Perspect Dev Neurobiol 4, 1996. 2. Sendtner M et al, J Neurol Sci 124 Suppl:77-83, 1994. 3. Sendtner M et al, J Cell Sci Suppl 15, 1991.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,7 kDa
NCBI Official Full Name
ciliary neurotrophic factor
NCBI Official Synonym Full Names
ciliary neurotrophic factor
NCBI Official Symbol
Cntf
NCBI Protein Information
ciliary neurotrophic factor; ciliary neurotropic factor
UniProt Protein Name
Ciliary neurotrophic factor
UniProt Gene Name
Cntf
UniProt Synonym Gene Names
CNTF
UniProt Entry Name
CNTF_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CNTF cntf (Catalog #AAA79301) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Rat CNTF reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: AFAEQTPLTL HRRDLCSRSI WLARKIRSDL TALMESYVKH QGLNKNINLD SVDGVPVAST DRWSEMTEAE RLQENLQAYR TFQGMLTKLL EDQRVHFTPT EGDFHQAIHT LMLQVSAFAY QLEELMVLLE QKIPENEADG MPATVGDGGL FEKKLWGLKV LQELSQWTVR SIHDLRVISS HQMGISALES HYGAKDKQM. It is sometimes possible for the material contained within the vial of "CNTF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.