Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Vascular Endothelial Growth Inhibitor Active Protein | VEGI active protein

Recombinant Human Vascular Endothelial Growth Inhibitor

Gene Names
TNFSF15; TL1; TL1A; VEGI; VEGI192A
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Vascular Endothelial Growth Inhibitor; N/A; Recombinant Human Vascular Endothelial Growth Inhibitor; VEGI Human; Human Vascular Endothelial Growth Inhibitor Recombinant; Tumor necrosis factor ligand superfamily member 15; TNFSF-15; TNFSF15; TNF ligand-related molecule 1; VEGI; TL-1; TL1; TL1A; VEGI192A; VEGI-192; MGC129934; MGC129935; VEGI active protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Sequence Length
192
Solubility
It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0x104 IU/mg.
Preparation and Storage
TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution VEGI should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for VEGI active protein
Description: TNFSF15 Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 20.5kDa. The TNFSF15 is purified by proprietary chromatographic techniques.

Introduction: TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of TNFSF15 is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. TNFSF15 is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.
Product Categories/Family for VEGI active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,131 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 15 isoform VEGI-192
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 15
NCBI Official Symbol
TNFSF15
NCBI Official Synonym Symbols
TL1; TL1A; VEGI; VEGI192A
NCBI Protein Information
tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor-192A
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 15
UniProt Gene Name
TNFSF15
UniProt Synonym Gene Names
TL1; VEGI
UniProt Entry Name
TNF15_HUMAN

Similar Products

Product Notes

The VEGI tnfsf15 (Catalog #AAA38546) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MQLTKGRLHF SHPLSHTKHI SPFVTDAPLR ADGDKPRAHL TVVRQTPTQH FKNQFPALHW EHELGLAFTK NRMNYTNKFL LIPESGDYFI YSQVTFRGMT SECSEIRQAG RPNKPDSITV VITKVTDSYP EPTQLLMGTK SVCEVGSNWF QPIYLGAMFS LQEGDKLMVN VSDISLVDYT KEDKTFFGAF LL. It is sometimes possible for the material contained within the vial of "Vascular Endothelial Growth Inhibitor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.