Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114769_SDS_PAGE15.jpg SDS-PAGE

papillomavirus type 18 Regulatory protein E2 Recombinant Protein | E2 recombinant protein

Recombinant Human papillomavirus type 18 Regulatory protein E2

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
papillomavirus type 18 Regulatory protein E2; N/A; Recombinant Human papillomavirus type 18 Regulatory protein E2; E2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-365aa; Full Length
Sequence
MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM
Sequence Length
365
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114769_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for E2 recombinant protein
E2 regulates viral transcription and DNA replication. It binds to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory region. It can either activate or repress transcription depending on E2RE's position with regards to proximal promoter elements. Repression occurs by sterically hindering the assembly of the transcription initiation complex. The E1-E2 complex binds to the origin of DNA replication.
Product Categories/Family for E2 recombinant protein
References
Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products.Cole S.T., Danos O.J. Mol. Biol. 193:599-608(1987) TaqI is a single cut enzyme for HPV-18.Meissner J.Nucleic Acids Res. 21:1041-1041(1993)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
43.3 kDa
NCBI Official Full Name
Regulatory protein E2
UniProt Protein Name
Regulatory protein E2
UniProt Gene Name
E2
UniProt Entry Name
VE2_HPV18

Similar Products

Product Notes

The E2 e2 (Catalog #AAA114769) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-365aa; Full Length. The amino acid sequence is listed below: MQTPKETLSE RLSCVQDKII DHYENDSKDI DSQIQYWQLI RWENAIFFAA REHGIQTLNH QVVPAYNISK SKAHKAIELQ MALQGLAQSA YKTEDWTLQD TCEELWNTEP THCFKKGGQT VQVYFDGNKD NCMTYVAWDS VYYMTDAGTW DKTATCVSHR GLYYVKEGYN TFYIEFKSEC EKYGNTGTWE VHFGNNVIDC NDSMCSTSDD TVSATQLVKQ LQHTPSPYSS TVSVGTAKTY GQTSAATRPG HCGLAEKQHC GPVNPLLGAA TPTGNNKRRK LCSGNTTPII HLKGDRNSLK CLRYRLRKHS DHYRDISSTW HWTGAGNEKT GILTVTYHSE TQRTKFLNTV AIPDSVQILV GYMTM. It is sometimes possible for the material contained within the vial of "papillomavirus type 18 Regulatory protein E2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.