papillomavirus type 52 Protein E7 Recombinant Protein | E7 recombinant protein
Recombinant Human papillomavirus type 52 Protein E7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
papillomavirus type 52 Protein E7; N/A; Recombinant Human papillomavirus type 52 Protein E7; E7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-99aa; Full Length
Sequence
MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL
Sequence Length
99
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for E7 recombinant protein
E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription.
References
Primer-directed sequencing of human papillomavirus types.Delius H., Hofmann B.Curr. Top. Microbiol. Immunol. 186:13-31(1994) Cloning and characterization of human papillomavirus type 52 from cervical carcinoma in Indonesia.Takami Y., Kondoh G., Saito J., Noda K., Sudiro T.M., Sjahrurachman A., Warsa U.C., Yutsudo M., Hakura A.Int. J. Cancer 48:516-522(1991) Interactions of SV40 large T antigen and other viral proteins with retinoblastoma tumour suppressor.Lee C., Cho Y.Rev. Med. Virol. 12:81-92(2002)
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The E7 e7 (Catalog #AAA114669) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-99aa; Full Length. The amino acid sequence is listed below: MRGDKATIKD YILDLQPETT DLHCYEQLGD SSDEEDTDGV DRPDGQAEQA TSNYYIVTYC HSCDSTLRLC IHSTATDLRT LQQMLLGTLQ VVCPGCARL. It is sometimes possible for the material contained within the vial of "papillomavirus type 52 Protein E7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
