Ephrin-B3 Recombinant Protein | Efnb3 recombinant protein
Recombinant Mouse Ephrin-B3
Gene Names
Efnb3; Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ephrin-B3; N/A; Recombinant Mouse Ephrin-B3; Efnb3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-227aa; Extracellular Domain
Sequence
LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
Sequence Length
340
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Efnb3 recombinant protein
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
References
Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.Bergemann A.D., Zhang L., Chiang M.-K., Brambilla R., Klein R., Flanagan J.G.Oncogene 16:471-480(1998) Complementary expression of transmembrane ephrins and their receptors in the mouse spinal cord a possible role in constraining the orientation of longitudinally projecting axons.Imondi R., Wideman C., Kaprielian Z.Development 127:1397-1410(2000) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
ephrin-B3
NCBI Official Synonym Full Names
ephrin B3
NCBI Official Symbol
Efnb3
NCBI Official Synonym Symbols
Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
NCBI Protein Information
ephrin-B3
UniProt Protein Name
Ephrin-B3
UniProt Gene Name
Efnb3
UniProt Entry Name
EFNB3_MOUSE
Similar Products
Product Notes
The Efnb3 efnb3 (Catalog #AAA114637) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-227aa; Extracellular Domain. The amino acid sequence is listed below: LSLEPVYWNS ANKRFQAEGG YVLYPQIGDR LDLLCPRARP PGPHSSPSYE FYKLYLVEGA QGRRCEAPPA PNLLLTCDRP DLDLRFTIKF QEYSPNLWGH EFRSHHDYYI IATSDGTREG LESLQGGVCL TRGMKVLLRV GQSPRGGAVP RKPVSEMPME RDRGAAHSAE PGRDTIPGDP SSNATSRGAE GPLPPPSMPA. It is sometimes possible for the material contained within the vial of "Ephrin-B3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
