SDS-PAGE
Enterotoxin type G Recombinant Protein | entG recombinant protein
Recombinant Staphylococcus aureus Enterotoxin type G
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Enterotoxin type G; N/A; Recombinant Staphylococcus aureus Enterotoxin type G; SEG; entG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-258aa; Full Length
Sequence
QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Sequence Length
258
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for entG recombinant protein
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
References
Whole genome sequencing of meticillin-resistant Staphylococcus aureus.Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y., Takahashi N.K., Sawano T., Inoue R., Kaito C., Sekimizu K., Hirakawa H., Kuhara S., Goto S., Yabuzaki J., Kanehisa M., Yamashita A., Oshima K., Furuya K., Yoshino C., Shiba T., Hattori M., Ogasawara N., Hayashi H., Hiramatsu K.Lancet 357:1225-1240(2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.0 kDa
NCBI Official Full Name
enterotoxin
UniProt Protein Name
Enterotoxin type G
UniProt Gene Name
entG
UniProt Synonym Gene Names
seg
UniProt Entry Name
ETXG_STAAM
Similar Products
Product Notes
The entG entg (Catalog #AAA115242) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-258aa; Full Length. The amino acid sequence is listed below: QPDPKLDELN KVSDYKNNKG TMGNVMNLYT SPPVEGRGVI NSRQFLSHDL IFPIEYKSYN EVKTELENTE LANNYKDKKV DIFGVPYFYT CIIPKSEPDI NQNFGGCCMY GGLTFNSSEN ERDKLITVQV TIDNRQSLGF TITTNKNMVT IQELDYKARH WLTKEKKLYE FDGSAFESGY IKFTEKNNTS FWFDLFPKKE LVPFVPYKFL NIYGDNKVVD SKSIKMEVFL NTH. It is sometimes possible for the material contained within the vial of "Enterotoxin type G, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.