Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA268036_SDS_PAGE15.png SDS-PAGE (The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained. Note: The molecular weight of the protein as observed on SDS-PAGE under reducing conditions may differ from its predicted value, due to variations in electrophoretic mobilities.)

STAT2 protein

Full length Signal transducer and activator of transcription 2

Average rating 0.0
No ratings yet
Gene Names
STAT2; P113; IMD44; ISGF-3; STAT113
Synonyms
STAT2; N/A; Full length Signal transducer and activator of transcription 2; STAT2 protein
Ordering
Host
Escherichia coli
Form/Format
Liquid
Sequence
DEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMV
Sequence Length
851
Buffer
Phosphate buffer saline
Purification Tag
6xHis at C-terminus
Organism
Homo sapiens (Human)
Full Length
851 amino acids
Preparation and Storage
Upon receipt, aliquot and store at -20°C to -80°C for 12 months. Avoid repeated freeze-thaw cycles.

SDS-PAGE

(The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained. Note: The molecular weight of the protein as observed on SDS-PAGE under reducing conditions may differ from its predicted value, due to variations in electrophoretic mobilities.)

product-image-AAA268036_SDS_PAGE15.png SDS-PAGE (The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained. Note: The molecular weight of the protein as observed on SDS-PAGE under reducing conditions may differ from its predicted value, due to variations in electrophoretic mobilities.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 13.5 kDa
NCBI Official Full Name
signal transducer and activator of transcription 2 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 2
NCBI Official Symbol
STAT2
NCBI Official Synonym Symbols
P113; IMD44; ISGF-3; STAT113
NCBI Protein Information
signal transducer and activator of transcription 2
UniProt Protein Name
Signal transducer and activator of transcription 2
UniProt Gene Name
STAT2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STAT2 stat2 (Catalog #AAA268036) is a Protein produced from Escherichia coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DEAFGCYYQE KVNLQERRKY LKHRLIVVSN RQVDELQQPL ELKPEPELES LELELGLVPE PELSLDLEPL LKAGLDLGPE LESVLESTLE PVIEPTLCMV. It is sometimes possible for the material contained within the vial of "STAT2, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.