Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Junctional adhesion molecule A (F11R) Recombinant Protein | F11R recombinant protein

Recombinant Cat Junctional adhesion molecule A (F11R), partial

Average rating 0.0
No ratings yet
Gene Names
F11R; JAM-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Junctional adhesion molecule A (F11R); N/A; Recombinant Cat Junctional adhesion molecule A (F11R), partial; F11R recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-237aa; partial (Extracellular domain)
Sequence
AVYTSEPDVRVPEDKPAKLSCSYSGFSNPRVEWKFAHGDITSLVCYKNKITASYADRVTFSHSGITFHSVTRKDTGTYTCMVSDDGGNTYGEVSVQLTVLVPPSKPTVHIPSSATIGSRAVLTCSEKDGSPPSEYYWFKDGVRMPLEPKGNRAFSNSSYSLNEKTGELVFDPVSAWDTGEYTCEAQNGYGMPMRSEAVRMEAAELNVGG
Species
Felis catus (Cat) (Felis silvestris catus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for F11R recombinant protein
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5 alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,579 Da
NCBI Official Full Name
junctional adhesion molecule A
NCBI Official Symbol
F11R
NCBI Official Synonym Symbols
JAM-1
NCBI Protein Information
junctional adhesion molecule A
UniProt Protein Name
Junctional adhesion molecule A
UniProt Gene Name
F11R
UniProt Synonym Gene Names
JAM1; JAM-A; JAM-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The F11R f11r (Catalog #AAA117055) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-237aa; partial (Extracellular domain). The amino acid sequence is listed below: AVYTSEPDVR VPEDKPAKLS CSYSGFSNPR VEWKFAHGDI TSLVCYKNKI TASYADRVTF SHSGITFHSV TRKDTGTYTC MVSDDGGNTY GEVSVQLTVL VPPSKPTVHI PSSATIGSRA VLTCSEKDGS PPSEYYWFKD GVRMPLEPKG NRAFSNSSYS LNEKTGELVF DPVSAWDTGE YTCEAQNGYG MPMRSEAVRM EAAELNVGG. It is sometimes possible for the material contained within the vial of "Junctional adhesion molecule A (F11R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.