Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113205_SDS_PAGE15.jpg SDS-PAGE

Fatty acid-binding protein Recombinant Protein | FABP1 recombinant protein

Recombinant Human Fatty acid-binding protein, liver

Gene Names
FABP1; FABPL; L-FABP
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Fatty acid-binding protein; N/A; Recombinant Human Fatty acid-binding protein, liver; Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP; FABP1 recombinant protein
Ordering
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-127
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Sequence Length
127
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113205_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for FABP1 recombinant protein
Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Product Categories/Family for FABP1 recombinant protein
References
Human liver fatty acid binding protein cDNA and amino acid sequence. Functional and evolutionary implications.Chan L., Wei C.-F., Li W.-H., Yang C.-Y., Ratner P., Pownall H., Gotto A.M. Jr., Smith L.C.J. Biol. Chem. 260:2629-2632(1985) Human liver fatty acid binding protein. Isolation of a full length cDNA and comparative sequence analyses of orthologous and paralogous proteins.Lowe J.B., Boguski M.S., Sweetser D.A., Elshourbagy N.A., Taylor J.M., Gordon J.I.J. Biol. Chem. 260:3413-3417(1985) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Rapid data collection for protein structure determination by NMR spectroscopy.Xu Y., Long D., Yang D.J. Am. Chem. Soc. 129:7722-7723(2007) Crystal structure of human FABP1.Structural genomics consortium (SGC) Submitted (DEC-2005) to the PDB data bank

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.6kD
NCBI Official Full Name
fatty acid-binding protein, liver
NCBI Official Synonym Full Names
fatty acid binding protein 1
NCBI Official Symbol
FABP1
NCBI Official Synonym Symbols
FABPL; L-FABP
NCBI Protein Information
fatty acid-binding protein, liver
UniProt Protein Name
Fatty acid-binding protein, liver
UniProt Gene Name
FABP1
UniProt Synonym Gene Names
FABPL; L-FABP
UniProt Entry Name
FABPL_HUMAN

Similar Products

Product Notes

The FABP1 fabp1 (Catalog #AAA113205) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127. The amino acid sequence is listed below: MSFSGKYQLQ SQENFEAFMK AIGLPEELIQ KGKDIKGVSE IVQNGKHFKF TITAGSKVIQ NEFTVGEECE LETMTGEKVK TVVQLEGDNK LVTTFKNIKS VTELNGDIIT NTMTLGDIVF KRISKRI. It is sometimes possible for the material contained within the vial of "Fatty acid-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.