Free fatty acid receptor 2 (FFAR2) Recombinant Protein | FFAR2 recombinant protein
Recombinant Human Free fatty acid receptor 2 (FFAR2)
Gene Names
FFAR2; FFA2R; GPR43
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Free fatty acid receptor 2 (FFAR2); N/A; Recombinant Human Free fatty acid receptor 2 (FFAR2); Recombinant Free fatty acid receptor 2 (FFAR2); Free fatty acid receptor 2; G-protein coupled receptor 43; FFAR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
277-330. Fragment at the C-terminal, provide the last complete extracellular domain.
Sequence
SSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Sequence Length
330
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,144 Da
NCBI Official Full Name
free fatty acid receptor 2
NCBI Official Synonym Full Names
free fatty acid receptor 2
NCBI Official Symbol
FFAR2
NCBI Official Synonym Symbols
FFA2R; GPR43
NCBI Protein Information
free fatty acid receptor 2; G protein-coupled receptor 43; G-protein coupled receptor 43; free fatty acid activated receptor 2
UniProt Protein Name
Free fatty acid receptor 2
UniProt Gene Name
FFAR2
UniProt Synonym Gene Names
GPR43
UniProt Entry Name
FFAR2_HUMAN
Similar Products
Product Notes
The FFAR2 ffar2 (Catalog #AAA114632) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 277-330. Fragment at the C-terminal, provide the last complete extracellular domain. The amino acid sequence is listed below: SSVVRRAFGR GLQVLRNQGS SLLGRRGKDT AEGTNEDRGV GQGEGMPSSD FTTE. It is sometimes possible for the material contained within the vial of "Free fatty acid receptor 2 (FFAR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.