Application Data
(Recombinant Mouse FGF-9 Protein promotes proliferation of BALB/3T3 mouse fibroblasts cells. The ED<sub>50</sub> for this effect is 2.52-10.06 ng/mL, corresponding to a specific activity of 9.94×10<sup>4</sup>~3.97×10<sup>5</sup> units/mg.)
FGF-9 recombinant protein
Recombinant Mouse FGF-9 Protein
Purity
>90% by SDS-PAGE.
Synonyms
FGF-9; N/A; Recombinant Mouse FGF-9 Protein; Fibroblast growth factor 9, FGF-9, Glia-activating factor, GAF, HBGF-9, Fgf9, Fgf-9; FGF-9 recombinant protein
Host
E coli
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Supplied as a 0.22 um filtered solution of solution of 20mM Tris-HCl, 250mM NaCl, 1mM EDTA, 20% Glycerol, 1mM DTT, pH8.5
Sequence
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Species
Mouse
Endotoxin
<0.1 EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 2.52-10.06ng/mL, corresponding to a specific activity of 9.94×104~3.97×105 units/mg.
Preparation and Storage
Store at -70 degree C. This product is stable at <= -70 degree C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Application Data
(Recombinant Mouse FGF-9 Protein promotes proliferation of BALB/3T3 mouse fibroblasts cells. The ED<sub>50</sub> for this effect is 2.52-10.06 ng/mL, corresponding to a specific activity of 9.94×10<sup>4</sup>~3.97×10<sup>5</sup> units/mg.)
Application Data
(Recombinant Mouse FGF-9 Protein promotes proliferation of BALB/3T3 mouse fibroblasts cells. The ED<sub>50</sub> for this effect is 2.52-10.06 ng/mL, corresponding to a specific activity of 9.94×10<sup>4</sup>~3.97×10<sup>5</sup> units/mg.)
SDS-PAGE
(Recombinant Mouse FGF-9 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-30 kDa.)
SDS-PAGE
(Recombinant Mouse FGF-9 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-30 kDa.)
Related Product Information for FGF-9 recombinant protein
Fibroblast growth factor 9 is also known as FGF9, GAF, HBFG-9, SYNS3, and is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF9 is also a mitogen for oligodendrocyte type 2 astrocyte progenitor cells, smooth muscle cells, pheochromocytoma PC12 cells, and BALB/3T3 fibroblasts. However, unlike FGF acidic and basic, FGF9 has no effect on human umbilical vein endothelial cells, and it has been demonstrated that FGF9 binds preferentially to the IIIc form of FGFR3. Although no typical signal sequence was found in FGF9, it is secreted efficiently after synthesis not in a conventional manner. In nervous system, FGF9 is produced mainly by neurons and may plays an important role in CNS development. FGF9 has been shown to interact with Fibroblast growth factor receptor 3.
Product Categories/Family for FGF-9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Fibroblast growth factor 9
UniProt Gene Name
Fgf9
UniProt Synonym Gene Names
Fgf-9; FGF-9; GAF
UniProt Entry Name
FGF9_MOUSE
Similar Products
Product Notes
The FGF-9 fgf9 (Catalog #AAA283379) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAPLGEVGSY FGVQDAVPFG NVPVLPVDSP VLLSDHLGQS EAGGLPRGPA VTDLDHLKGI LRRRQLYCRT GFHLEIFPNG TIQGTRKDHS RFGILEFISI AVGLVSIRGV DSGLYLGMNE KGELYGSEKL TQECVFREQF EENWYNTYSS NLYKHVDTGR RYYVALNKDG TPREGTRTKR HQKFTHFLPR PVDPDKVPEL YKDILSQS. It is sometimes possible for the material contained within the vial of "FGF-9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.