fimbrin D-mannose specific adhesin (fimH) Recombinant Protein | fimH recombinant protein

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH)

Cat. Num. AAA18545

• Gene Names: fimH; ECK4311; JW4283
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: fimbrin D-mannose specific adhesin (fimH); N/A; Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH); fimH recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-300aa; Full Length of Mature Protein
• Sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for fimH recombinant protein

Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

References

Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445(1987) FimH family of type 1 fimbrial adhesins functional heterogeneity due to minor sequence variations among fimH genes.Sokurenko E.V., Courtney H.S., Ohman D.E., Klemm P., Hasty D.L.J. Bacteriol. 176:748-755(1994) Analysis of the Escherichia coli genome VI DNA sequence of the region from 92.8 through 100 minutes.Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Purification of the Escherichia coli type 1 pilin and minor pilus proteins and partial characterization of the adhesin protein.Hanson M.S., Hempel J., Brinton C.C. Jr.J. Bacteriol. 170:3350-3358(1988) Direct evidence that the FimH protein is the mannose-specific adhesin of Escherichia coli type 1 fimbriae.Krogfelt K.A., Bergmans H., Klemm P.Infect. Immun. 58:1995-1998(1990) Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Auguste C.G., Strouse R., Langermann S., Waksman G., Hultgren S.J.Mol. Microbiol. 44:903-915(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 16132141
• NCBI GeneID: 948847
• NCBI Accession #: NP_418740.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P08191; Q2M5Z3
• Molecular Weight: 31.1 kDa
• NCBI Official Full Name: minor component of type 1 fimbriae
• NCBI Official Symbol: fimH
• NCBI Official Synonym Symbols: ECK4311; JW4283
• NCBI Protein Information: minor component of type 1 fimbriae
• UniProt Protein Name: Protein FimH
• UniProt Gene Name: fimH
• UniProt Entry Name: FIMH_ECOLI