Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114558_SDS_PAGE15.jpg SDS-PAGE

Fucose-1-phosphate guanylyltransferase (FPGT) Recombinant Protein | FPGT recombinant protein

Recombinant Human Fucose-1-phosphate guanylyltransferase (FPGT)

Gene Names
FPGT; GFPP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fucose-1-phosphate guanylyltransferase (FPGT); N/A; Recombinant Human Fucose-1-phosphate guanylyltransferase (FPGT); FPGT recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-594aa, Full length
Sequence
MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM
Sequence Length
169
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA114558_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for FPGT recombinant protein
L-fucose is a key sugar in glycoproteins and other complex carbohydrates since it may be involved in many of the functional roles of these macromolecules, such as in cell-cell recognition. The fucosyl donor for these fucosylated oligosaccharides is GDP-beta-L-fucose. There are two alternate pathways for the biosynthesis of GDP-fucose; the major pathway converts GDP-alpha-D-mannose to GDP-beta-L-fucose. This protein participates in an alternate pathway that is present in certain mammalian tissues, such as liver and kidney, and appears to function as a salvage pathway to reutilize L-fucose arising from the turnover of glycoproteins and glycolipids. This pathway involves the phosphorylation of L-fucose to form beta-L-fucose-1-phosphate, and then condensation of the beta-L-fucose-1-phosphate with GTP by fucose-1-phosphate guanylyltransferase to form GDP-beta-L-fucose.
Product Categories/Family for FPGT recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68.6 kDa
NCBI Official Full Name
fucose-1-phosphate guanylyltransferase isoform 3
NCBI Official Synonym Full Names
fucose-1-phosphate guanylyltransferase
NCBI Official Symbol
FPGT
NCBI Official Synonym Symbols
GFPP
NCBI Protein Information
fucose-1-phosphate guanylyltransferase
UniProt Protein Name
Fucose-1-phosphate guanylyltransferase
UniProt Gene Name
FPGT
UniProt Synonym Gene Names
GFPP

Similar Products

Product Notes

The FPGT fpgt (Catalog #AAA114558) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-594aa, Full length. The amino acid sequence is listed below: MAAARDPPEV SLREATQRKL RRFSELRGKL VARGEFWDIV AITAADEKQE LAYNQQLSEK LKRKELPLGV QYHVFVDPAG AKIGNGGSTL CALQCLEKLY GDKWNSFTIL LIHSGGYSQR LPNASALGKI FTALPLGNPI YQMLELKLAM YIDFPLNMNP GILVTCADDI ELYSIGEFEF IRFDKPGFTA LAHPSSLTIG TTHGVFVLDP FDDLKHRDLE YRSCHRFLHK PSIEKMYQFN AVCRPGNFCQ QDFAGGDIAD LKLDSDYVYT DSLFYMDHKS AKMLLAFYEK IGTLSCEIDA YGDFLQALGP GATVEYTRNT SNVIKEESEL VEMRQRIFHL LKGTSLNVVV LNNSKFYHIG TTEEYLFYFT SDNSLKSELG LQSITFSIFP DIPECSGKTS CIIQSILDSR CSVAPGSVVE YSRLGPDVSV GENCIISGSY ILTKAALPAH SFVCSLSLKM NRCLKYATMA FGVQDNLKKS VKTLSDIKLL QFFGVCFLSC LDVWNLKVTE ELFSGNKTCL SLWTARIFPV CSSLSDSVIT SLKMLNAVKN KSAFSLNSYK LLSIEEMLIY KDVEDMITYR EQIFLEISLK SSLM. It is sometimes possible for the material contained within the vial of "Fucose-1-phosphate guanylyltransferase (FPGT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.