Follicle-stimulating hormone receptor (FSHR) Recombinant Protein | FSHR recombinant protein
Recombinant Human Follicle-stimulating hormone receptor (FSHR), partial
Gene Names
                                                    FSHR; LGR1; ODG1; FSHR1; FSHRO
                                                Purity
                                                    Greater or equal to 85% purity as determined by SDS-PAGE.
                                                Synonyms
                                            Follicle-stimulating hormone receptor (FSHR); N/A; Recombinant Human Follicle-stimulating hormone receptor (FSHR), partial; Follitropin receptor; FSHR recombinant protein
                                        
                    Host                
                
                    E Coli or Yeast or Baculovirus or Mammalian Cell                
            
                    Purity/Purification                
                
                    Greater or equal to 85% purity as determined by SDS-PAGE.                
            
                    Form/Format                
                
                    Lyophilized or liquid (Format to be determined during the manufacturing process)                
            
                    Sequence Positions                
                
                    18-366aa; Partial                
            
                    Sequence                
                
                    CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
                
            
                    Preparation and Storage                
                
                    Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.                
            
                    Related Product Information for FSHR recombinant protein                
                
                 
                    Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.                 
                
            
                    Product Categories/Family for FSHR recombinant protein                
                
            
                    References                
                
                    Cloning and sequencing of human FSH receptor cDNA.Minegish T., Nakamura K., Takakura Y., Ibuki Y., Igarashi M.Biochem. Biophys. Res. Commun. 175:1125-1130(1991)
 Expression of recombinant human follicle-stimulating hormone receptor
species-specific ligand binding, signal transduction, and identification of multiple ovarian messenger ribonucleic acid transcripts.Tilly J.L., Aihara T., Nishimori K., Jia X.-C., Billig H., Kowalski K.I., Perlas E.A., Hsueh A.J.Endocrinology 131:799-806(1992)
 The cloning of the human follicle stimulating hormone receptor and its expression in COS-7, CHO, and Y-1 cells.Kelton C.A., Cheng S.V., Nugent N.P., Schweickhardt R.L., Rosenthal J.L., Overton S.A., Wands G.D., Kuzeja J.B., Luchette C.A., Chappel S.C.Mol. Cell. Endocrinol. 89:141-151(1992)
 FSHR expression in adipose tissue.Liu X., Huang H., Sheng J. cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)
.Kopatz S.A., Aronstam R.S., Sharma S.V. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)
 Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
 Molecular cloning of a truncated isoform of the human follicle stimulating hormone receptor.Gromoll J., Gudermann T., Nieschlag E.Biochem. Biophys. Res. Commun. 188:1077-1083(1992)
 Characterization of the 5' flanking region of the human follicle-stimulating hormone receptor gene.Gromoll J., Dankbar B., Gudermann T.Mol. Cell. Endocrinol. 102:93-102(1994)
 Localization of the human FSH receptor to chromosome 2p21 using a genomic probe comprising exon 10.Gromoll J., Ried T., Holtgreve-Grez H., Nieschlag E., Gudermann T.J. Mol. Endocrinol. 12:265-271(1994)
 Alternatively spliced variants of the follicle-stimulating hormone receptor gene in the testis of infertile men.Song G.J., Park Y.S., Lee Y.S., Lee C.C., Kang I.S.Fertil. Steril. 77:499-504(2002)
 Structural predictions for the ligand-binding region of glycoprotein hormone receptors and the nature of hormone-receptor interactions.Jiang X., Dreano M., Buckler D.R., Cheng S., Ythier A., Wu H., Hendrickson W.A., el Tayar N.Structure 3:1341-1353(1995)
 Structure of human follicle-stimulating hormone in complex with its receptor.Fan Q.R., Hendrickson W.A.Nature 433:269-277(2005)
 Mutation in the follicle-stimulating hormone receptor gene causes hereditary hypergonadotropic ovarian failure.Aittomaeki K., Lucena J.L.D., Pakarinen P., Sistonen P., Tapanainen J., Gromoll J., Kaskikari R., Sankila E.-M., Lehvaslaiho H., Engel A.R., Nieschlag E., Huhtaniemi I., de la Chapelle A.Cell 82:959-968(1995)
 A mutation in the follicle-stimulating hormone receptor occurs frequently in human ovarian sex cord tumors.Kotlar T.J., Young R.H., Albanese C., Crowley W.F. Jr., Scully R.E., Jameson J.L.J. Clin. Endocrinol. Metab. 82:1020-1026(1997)
 An activating mutation of the follicle-stimulating hormone receptor autonomously sustains spermatogenesis in a hypophysectomized man.Gromoll J., Simoni M., Nieschlag E.J. Clin. Endocrinol. Metab. 81:1367-1370(1996)
 The frequency of an inactivating point mutation (566C-->T)
 of the human follicle-stimulating hormone receptor gene in four populations using allele-specific hybridization and time-resolved fluorometry.Jiang M., Aittomaeki K., Nilsson C., Pakarinen P., Iitia A., Torresani T., Simonsen H., Goh V., Pettersson K., de la Chapelle A., Huhtaniemi I.J. Clin. Endocrinol. Metab. 83:4338-4343(1998)
 A novel phenotype related to partial loss of function mutations of the follicle stimulating hormone receptor.Beau I., Touraine P., Meduri G., Gougeon A., Desroches A., Matuchansky C., Milgrom E., Kuttenn F., Misrahi M.J. Clin. Invest. 102:1352-1359(1998)
 New natural inactivating mutations of the follicle-stimulating hormone receptor
correlations between receptor function and phenotype.Touraine P., Beau I., Gougeon A., Meduri G., Desroches A., Pichard C., Detoeuf M., Paniel B., Prieur M., Zorn J.-R., Milgrom E., Kuttenn F., Misrahi M.Mol. Endocrinol. 13:1844-1854(1999)
 Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999)
 ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999)
Distribution and function of FSH receptor genetic variants in normal men.Asatiani K., Gromoll J., Eckardstein S.V., Zitzmann M., Nieschlag E., Simoni M.Andrologia 34:172-176(2002)
 A novel mutation in the FSH receptor inhibiting signal transduction and causing primary ovarian failure.Doherty E., Pakarinen P., Tiitinen A., Kiilavuori A., Huhtaniemi I., Forrest S., Aittomaeki K.J. Clin. Endocrinol. Metab. 87:1151-1155(2002)
 A novel loss of function mutation in exon 10 of the FSH receptor gene causing hypergonadotrophic hypogonadism
clinical and molecular characteristics.Allen L.A., Achermann J.C., Pakarinen P., Kotlar T.J., Huhtaniemi I.T., Jameson J.L., Cheetham T.D., Ball S.G.Hum. Reprod. 18:251-256(2003)
 Delayed puberty and primary amenorrhea associated with a novel mutation of the human follicle-stimulating hormone receptor
clinical, histological, and molecular studies.Meduri G., Touraine P., Beau I., Lahuna O., Desroches A., Vacher-Lavenu M.C., Kuttenn F., Misrahi M.J. Clin. Endocrinol. Metab. 88:3491-3498(2003)
 A chorionic gonadotropin-sensitive mutation in the follicle-stimulating hormone receptor as a cause of familial gestational spontaneous ovarian hyperstimulation syndrome.Vasseur C., Rodien P., Beau I., Desroches A., Gerard C., de Poncheville L., Chaplot S., Savagner F., Croue A., Mathieu E., Lahlou N., Descamps P., Misrahi M.N. Engl. J. Med. 349:753-759(2003)
 Ovarian hyperstimulation syndrome due to a mutation in the follicle-stimulating hormone receptor.Smits G., Olatunbosun O., Delbaere A., Pierson R., Vassart G., Costagliola S.N. Engl. J. Med. 349:760-766(2003)
 A mutation in the follicle-stimulating hormone receptor as a cause of familial spontaneous ovarian hyperstimulation syndrome.Montanelli L., Delbaere A., Di Carlo C., Nappi C., Smits G., Vassart G., Costagliola S.J. Clin. Endocrinol. Metab. 89:1255-1258(2004)
 Presence and absence of follicle-stimulating hormone receptor mutations provide some insights into spontaneous ovarian hyperstimulation syndrome physiopathology.De Leener A., Montanelli L., Van Durme J., Chae H., Smits G., Vassart G., Costagliola S.J. Clin. Endocrinol. Metab. 91:555-562(2006)
 Identification of the first germline mutation in the extracellular domain of the follitropin receptor responsible for spontaneous ovarian hyperstimulation syndrome.De Leener A., Caltabiano G., Erkan S., Idil M., Vassart G., Pardo L., Costagliola S.Hum. Mutat. 29:91-98(2008)
 +Additional computationally mapped references.<p>Provides general information on the entry.                
            NCBI and Uniprot Product Information
                    NCBI GI #                
                
            
                    NCBI GeneID                
                
            
                    NCBI Accession #                
                
            
                    NCBI GenBank Nucleotide #                
                
            
                    Molecular Weight                
                
                                            41.0 kDa                                    
            
                    NCBI Official Full Name                
                
                    follicle-stimulating hormone receptor isoform 1                
            
                    NCBI Official Synonym Full Names                
                
                    follicle stimulating hormone receptor                
            
                    NCBI Official Symbol                
                
                    FSHR                 
            
                    NCBI Official Synonym Symbols                
                
                    LGR1; ODG1; FSHR1; FSHRO                 
            
                    NCBI Protein Information                
                
                    follicle-stimulating hormone receptor                
            
                    UniProt Protein Name                
                
                    Follicle-stimulating hormone receptor                
            
                    UniProt Gene Name                
                
                    FSHR                
            
                    UniProt Synonym Gene Names                
                
                    LGR1; FSH-R                
            
                    UniProt Entry Name                
                
                    FSHR_HUMAN                
            Similar Products
Product Notes
The FSHR fshr (Catalog #AAA18508) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-366aa; Partial. The amino acid sequence is listed below: CHHRICHCSN RVFLCQESKV TEIPSDLPRN AIELRFVLTK LRVIQKGAFS GFGDLEKIEI SQNDVLEVIE ADVFSNLPKL HEIRIEKANN LLYINPEAFQ NLPNLQYLLI SNTGIKHLPD VHKIHSLQKV LLDIQDNINI HTIERNSFVG LSFESVILWL NKNGIQEIHN CAFNGTQLDE LNLSDNNNLE ELPNDVFHGA SGPVILDISR TRIHSLPSYG LENLKKLRAR STYNLKKLPT LEKLVALMEA SLTYPSHCCA FANWRRQISE LHPICNKSIL RQEVDYMTQA RGQRSSLAED NESSYSRGFD MTYTEFDYDL CNEVVDVTCS PKPDAFNPCE DIMGYNILR . It is sometimes possible for the material contained within the vial of "Follicle-stimulating hormone receptor (FSHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.

 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                