Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114487_SDS_PAGE15.jpg SDS-PAGE

Envelope glycoprotein B Recombinant Protein | gB recombinant protein

Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Envelope glycoprotein B

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein B; N/A; Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Envelope glycoprotein B; GP115; Glycoprotein GP110; gB recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-260aa; Partial
Sequence
QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114487_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for gB recombinant protein
Envelope glycoprotein that forms spikes at the surface of virion envelope. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding of gp350/220 to its receptor, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis
References
"Epstein-Barr virus glycoprotein homologous to herpes simplex virus gB." Gong M., Ooka T., Matsuo T., Kieff E. J. Virol. 61:499-508(1987)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.3 kDa
NCBI Official Full Name
glycoprotein gp110
NCBI Official Symbol
BALF4
NCBI Protein Information
glycoprotein gp110 precursor
UniProt Protein Name
Envelope glycoprotein B
UniProt Gene Name
gB
UniProt Synonym Gene Names
gB
UniProt Entry Name
GB_EBVB9

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The gB gb (Catalog #AAA114487) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-260aa; Partial. The amino acid sequence is listed below: QTPEQPAPPA TTVQPTATRQ QTSFPFRVCE LSSHGDLFRF SSDIQCPSFG TRENHTEGLL MVFKDNIIPY SFKVRSYTKI VTNILIYNGW YADSVTNRHE EKFSVDSYET DQMDTIYQCY NAVKMTKDGL TRVYVDRDGV NITVNLKPTG GLANGVRRYA SQTELYDAPG WLIWTYRTRT TVNCLITDMM AKSNSPFDFF VTTTGQTVEM SPFYDGKNKE TFHERADSFH VRTNYKIV. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.