Zinc finger protein GLI2 Recombinant Protein | GLI2 recombinant protein
Recombinant Human Zinc finger protein GLI2
Gene Names
GLI2; CJS; HPE9; PHS2; THP1; THP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein GLI2; N/A; Recombinant Human Zinc finger protein GLI2; GLI family zinc finger protein 2; Tax helper protein; GLI2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
412-641aa; Partial
Sequence
EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Sequence Length
641
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for GLI2 recombinant protein
Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal emembryonic development (PubMed:15994174, PubMed:20685856). By similarity1 Publication5 Publications Isoform 1, isoform 2, isoform 3 and isoform 4: Act as transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Bind to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1 (PubMed:9557682). Are involved in the smoothened (SHH) signaling pathway (PubMed:18455992). 3 Publications Isoform 5: Acts as a transcriptional repressor.
Product Categories/Family for GLI2 recombinant protein
References
"Cloning of novel isoforms of the human Gli2 oncogene and their activities to enhance tax-dependent transcription of the human T-cell leukemia virus type 1 genome." Tanimura A., Dan S., Yoshida M. J. Virol. 72:3958-3964(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.5 kDa
NCBI Official Full Name
zinc finger protein GLI2
NCBI Official Synonym Full Names
GLI family zinc finger 2
NCBI Official Symbol
GLI2
NCBI Official Synonym Symbols
CJS; HPE9; PHS2; THP1; THP2
NCBI Protein Information
zinc finger protein GLI2
UniProt Protein Name
Zinc finger protein GLI2
UniProt Gene Name
GLI2
UniProt Entry Name
GLI2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GLI2 gli2 (Catalog #AAA114000) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 412-641aa; Partial. The amino acid sequence is listed below: EQLADLKEDL DRDDCKQEAE VVIYETNCHW EDCTKEYDTQ EQLVHHINNE HIHGEKKEFV CRWQACTREQ KPFKAQYMLV VHMRRHTGEK PHKCTFEGCS KAYSRLENLK THLRSHTGEK PYVCEHEGCN KAFSNASDRA KHQNRTHSNE KPYICKIPGC TKRYTDPSSL RKHVKTVHGP DAHVTKKQRN DVHLRTPLLK ENGDSEAGTE PGGPESTEAS STSQAVEDCL. It is sometimes possible for the material contained within the vial of "Zinc finger protein GLI2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
