Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Golgin subfamily A member 2 (Golga2) Recombinant Protein | Golga2 recombinant protein

Recombinant Mouse Golgin subfamily A member 2 (Golga2) , partial

Average rating 0.0
No ratings yet
Gene Names
Golga2; GM130; AW555139; mKIAA4150
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgin subfamily A member 2 (Golga2); N/A; Recombinant Mouse Golgin subfamily A member 2 (Golga2) , partial; Golga2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
800-999aa; partial
Sequence
VAMEKLQSRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPGDVLTPVPTGSQEFGAADQQDDLREVSLADDIEPAQGEAGVPAPHENPTAQQIMQLLREIQNPRERPGLGSNPCIPFFYRADENDEVKIMVV
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Golga2 recombinant protein
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which This protein is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110,048 Da
NCBI Official Full Name
golgin subfamily A member 2 isoform b
NCBI Official Synonym Full Names
golgi autoantigen, golgin subfamily a, 2
NCBI Official Symbol
Golga2
NCBI Official Synonym Symbols
GM130; AW555139; mKIAA4150
NCBI Protein Information
golgin subfamily A member 2
UniProt Protein Name
Golgin subfamily A member 2
UniProt Gene Name
Golga2
UniProt Synonym Gene Names
GM130

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Golga2 golga2 (Catalog #AAA117474) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 800-999aa; partial. The amino acid sequence is listed below: VAMEKLQSRF LEVMQEKVEL KERVEELEHC CIQLSGETDT IGEYIALYQN QRAVLKARHL EKEEYISRLA QDKEEMKVKL LELQELVLRL VNERNEWQGK FLAVSQNPGD VLTPVPTGSQ EFGAADQQDD LREVSLADDI EPAQGEAGVP APHENPTAQQ IMQLLREIQN PRERPGLGSN PCIPFFYRAD ENDEVKIMVV. It is sometimes possible for the material contained within the vial of "Golgin subfamily A member 2 (Golga2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.