Platelet glycoprotein Ib beta chain (GP1BB) Recombinant Protein | GP1BB recombinant protein
Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB), partial
Gene Names
GP1BB; BS; CD42C; GPIBB; BDPLT1; GPIbbeta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet glycoprotein Ib beta chain (GP1BB); N/A; Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB), partial; GP1BB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-147aa; partial
Sequence
PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GP1BB recombinant protein
Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this product has been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissues such as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signal within a separate gene (septin 5) located upstream of this gene. In the absence of polyadenylation from its own imperfect site, the septin 5 gene uses the consensus polyA signal of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,158 Da
NCBI Official Full Name
platelet glycoprotein Ib beta chain
NCBI Official Synonym Full Names
glycoprotein Ib platelet beta subunit
NCBI Official Symbol
GP1BB
NCBI Official Synonym Symbols
BS; CD42C; GPIBB; BDPLT1; GPIbbeta
NCBI Protein Information
platelet glycoprotein Ib beta chain
UniProt Protein Name
Platelet glycoprotein Ib beta chain
UniProt Gene Name
GP1BB
UniProt Synonym Gene Names
GP-Ib beta; GPIb-beta; GPIbB
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GP1BB gp1bb (Catalog #AAA235242) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-147aa; partial. The amino acid sequence is listed below: PAPCSCAGTL VDCGRRGLTW ASLPTAFPVD TTELVLTGNN LTALPPGLLD ALPALRTAHL GANPWRCDCR LVPLRAWLAG RPERAPYRDL RCVAPPALRG RLLPYLAEDE LRAACAPGPL C. It is sometimes possible for the material contained within the vial of "Platelet glycoprotein Ib beta chain (GP1BB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.