Glypican 3 Recombinant Protein | GPC3 recombinant protein
Recombinant Human Glypican 3 (GPC3)
Gene Names
GPC3; SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
Purity
> 90% as determined by SDS-PAGE.
Synonyms
Glypican 3; N/A; Recombinant Human Glypican 3 (GPC3); DGSX; OCI5; SDYS; SGB; SGBS1; MXR7; Glypican Proteoglycan 3; GTR2-2; Intestinal protein OCI-5; Secreted glypican-3.; GPC3 recombinant protein
Host
E. coli AA 121-220 (P51654).
Purity/Purification
> 90% as determined by SDS-PAGE.
Form/Format
0.15 M PBS, pH 7.5, with 10% glycerol
Concentration
1 mg/mL (varies by lot)
Sequence
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS
Sequence Length
58
Source
Human
Protein Residues
with N-terminal 6×His-tag.
Usage
GPC3 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20 degree C upon receiving. Avoid repeated freeze-thaw cycles.
Recommend to aliquot the protein into smaller quantities for optimal storage.
The recombinant protein is stable for up to 6 months from date of receipt at -80 degree C.
Recommend to aliquot the protein into smaller quantities for optimal storage.
The recombinant protein is stable for up to 6 months from date of receipt at -80 degree C.
Related Product Information for GPC3 recombinant protein
Glypican 3, also known as GPC3, The protein encoded by this gene is a member of the glypican family.Glypican 3 immunostaining has utility for differentiating hepatocellular carcinoma (HCC) and dysplastic changes in cirrhotic livers; HCC stains with glypican 3, while liver with dysplastic changes and/or cirrhotic changes does not.
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation.
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
30 kDa
NCBI Official Full Name
glypican 3, partial
NCBI Official Synonym Full Names
glypican 3
NCBI Official Symbol
GPC3
NCBI Official Synonym Symbols
SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
NCBI Protein Information
glypican-3; secreted glypican-3; glypican proteoglycan 3; intestinal protein OCI-5; heparan sulphate proteoglycan
UniProt Protein Name
Glypican-3
UniProt Gene Name
GPC3
UniProt Synonym Gene Names
OCI5
UniProt Entry Name
GPC3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GPC3 gpc3 (Catalog #AAA55768) is a Recombinant Protein produced from E. coli AA 121-220 (P51654). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HAKNYTNAMF KNNYPSLTPQ AFEFVGEFFT DVSLYILGSD INVDDMVNEL FDSLFPVIYT QLMNPGLPDS ALDINECLRG ARRDLKVFGN FPKLIMTQVS. It is sometimes possible for the material contained within the vial of "Glypican 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
