SDS-PAGE
Phospholipid hydroperoxide glutathione peroxidase Recombinant Protein | GPX4 recombinant protein
Recombinant ongo pygmaeus (Bornean orangutan) Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phospholipid hydroperoxide glutathione peroxidase; N/A; Recombinant ongo pygmaeus (Bornean orangutan) Phospholipid hydroperoxide glutathione peroxidase, mitochondrial; Glutathione peroxidase 4; GPx-4; GSHPx-4; GPX4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-170aa; Cytoplasmic Domain
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
Sequence Length
197
Species
ongo pygmaeus (Bornean orangutan)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for GPX4 recombinant protein
Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for emembryonic development. Protects from radiation and oxidative damage
References
"Structure, gene expression, and evolution of primate glutathione peroxidases." Fukuhara R., Kageyama T. Comp. Biochem. Physiol. 141B:428-436(2005)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
UniProt Protein Name
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
UniProt Gene Name
GPX4
UniProt Synonym Gene Names
PHGPx; GPx-4; GSHPx-4
UniProt Entry Name
GPX4_PONPY
Similar Products
Product Notes
The GPX4 gpx4 (Catalog #AAA117191) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-170aa; Cytoplasmic Domain. The amino acid sequence is listed below: MSLGRLCRLL KPALLCGALA APGLAGTMCA SRDDWRCARS MHEFSAKDID GHMVNLDKYR GFVCIVTNVA SQUGKTEVNY TQLVDLHARY AECGLRILAF PCNQFGKQEP GSNEEIKEFA AGYNVKFDMF SKICVNGDDA HPLWKWMKIQ PKGKGILGNA IKWNFTKFLI. It is sometimes possible for the material contained within the vial of "Phospholipid hydroperoxide glutathione peroxidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.