Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113267_SEQUENCE15.jpg Sequence (The amino acid at the 73 site is ‘U’ in UniProt (yellow highlighted with red arrow, reference P36969) and has been mutated to ‘S’ to manufacture the AAA113267 GPX4 recombinant protein. This is because ‘U’ selenocysteine, which is encoded by UGA, is normally used as a stop codon in prokaryotic cells,. The stop codon leads to early termination of translation. Hence the lab mutates ‘U’ at the 73 site to ‘S’ for protein expression. Additional information: Selenocysteine is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The lab typically mutates ‘U’ to serine for protein expression because mutating ‘U’ to cysteine may result in the formation of additional disulfide bonds, potentially affecting the expression and structure of the protein.)

Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4) Recombinant Protein | GPX4 recombinant protein

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4) , partial

Average rating 0.0
No ratings yet
Gene Names
GPX4; MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4); N/A; Recombinant Human Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4) , partial; GPX4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-197aa(U73S); Partial
Sequence
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Sequence

(The amino acid at the 73 site is ‘U’ in UniProt (yellow highlighted with red arrow, reference P36969) and has been mutated to ‘S’ to manufacture the AAA113267 GPX4 recombinant protein. This is because ‘U’ selenocysteine, which is encoded by UGA, is normally used as a stop codon in prokaryotic cells,. The stop codon leads to early termination of translation. Hence the lab mutates ‘U’ at the 73 site to ‘S’ for protein expression. Additional information: Selenocysteine is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The lab typically mutates ‘U’ to serine for protein expression because mutating ‘U’ to cysteine may result in the formation of additional disulfide bonds, potentially affecting the expression and structure of the protein.)

product-image-AAA113267_SEQUENCE15.jpg Sequence (The amino acid at the 73 site is ‘U’ in UniProt (yellow highlighted with red arrow, reference P36969) and has been mutated to ‘S’ to manufacture the AAA113267 GPX4 recombinant protein. This is because ‘U’ selenocysteine, which is encoded by UGA, is normally used as a stop codon in prokaryotic cells,. The stop codon leads to early termination of translation. Hence the lab mutates ‘U’ at the 73 site to ‘S’ for protein expression. Additional information: Selenocysteine is a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. The lab typically mutates ‘U’ to serine for protein expression because mutating ‘U’ to cysteine may result in the formation of additional disulfide bonds, potentially affecting the expression and structure of the protein.)
Related Product Information for GPX4 recombinant protein
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,525 Da
NCBI Official Full Name
phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform B
NCBI Official Synonym Full Names
glutathione peroxidase 4
NCBI Official Symbol
GPX4
NCBI Official Synonym Symbols
MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx
NCBI Protein Information
phospholipid hydroperoxide glutathione peroxidase, mitochondrial; phospholipid hydroperoxide glutathione peroxidase
UniProt Protein Name
Phospholipid hydroperoxide glutathione peroxidase
UniProt Gene Name
GPX4
UniProt Synonym Gene Names
GSHPx-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPX4 gpx4 (Catalog #AAA113267) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-197aa(U73S); Partial. The amino acid sequence is listed below: CASRDDWRCA RSMHEFSAKD IDGHMVNLDK YRGFVCIVTN VASQSGKTEV NYTQLVDLHA RYAECGLRIL AFPCNQFGKQ EPGSNEEIKE FAAGYNVKFD MFSKICVNGD DAHPLWKWMK IQPKGKGILG NAIKWNFTKF LIDKNGCVVK RYGPMEEPLV IEKDLPHYF. It is sometimes possible for the material contained within the vial of "Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.