Griffithsin Recombinant Protein | GRFT recombinant protein

Recombinant Griffithsia sp. Griffithsin

Cat. Num. AAA18661

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Griffithsin; N/A; Recombinant Griffithsia sp. Griffithsin; GRFT recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-121aa(X31S); Full Length Protein
• Sequence: SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY

• Species: Griffithsia sp. (strain Q66D336) (Red alga)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Sequence Information

(Griffithsia sp. Griffithsin Uniprot (P84801) sequence contains 'X' (red arrow), 'X' refers to any amino acid. The 'X' is replaced with 'S' for protein manufacture.)

NCBI and Uniprot Product Information

• NCBI GI #: 90101331
• UniProt Accession #: P84801
• Molecular Weight: 12,731 Da
• NCBI Official Full Name: Griffithsin
• UniProt Protein Name: Griffithsin
• UniProt Gene Name: GRFT
• UniProt Synonym Gene Names: GRFT