Glutamate receptor 1 (GRIA1) Recombinant Protein | GRIA1 recombinant protein
Recombinant Human Glutamate receptor 1 (GRIA1) , partial
Gene Names
GRIA1; GLUH1; GLUR1; GLURA; GluA1; HBGR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate receptor 1 (GRIA1); N/A; Recombinant Human Glutamate receptor 1 (GRIA1) , partial; GRIA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-536. Partial (Extracellular domain)
Sequence
ANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLA
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
102,864 Da
NCBI Official Full Name
glutamate receptor 1 isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor AMPA type subunit 1
NCBI Official Symbol
GRIA1
NCBI Official Synonym Symbols
GLUH1; GLUR1; GLURA; GluA1; HBGR1
NCBI Protein Information
glutamate receptor 1
UniProt Protein Name
Glutamate receptor 1
UniProt Gene Name
GRIA1
UniProt Synonym Gene Names
GLUH1; GLUR1; GluR-1; GluA1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GRIA1 gria1 (Catalog #AAA114125) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-536. Partial (Extracellular domain). The amino acid sequence is listed below: ANFPNNIQIG GLFPNQQSQE HAAFRFALSQ LTEPPKLLPQ IDIVNISDSF EMTYRFCSQF SKGVYAIFGF YERRTVNMLT SFCGALHVCF ITPSFPVDTS NQFVLQLRPE LQDALISIID HYKWQKFVYI YDADRGLSVL QKVLDTAAEK NWQVTAVNIL TTTEEGYRML FQDLEKKKER LVVVDCESER LNAILGQIIK LEKNGIGYHY ILANLGFMDI DLNKFKESGA NVTGFQLVNY TDTIPAKIMQ QWKNSDARDH TRVDWKRPKY TSALTYDGVK VMAEAFQSLR RQRIDISRRG NAGDCLANPA VPWGQGIDIQ RALQQVRFEG LTGNVQFNEK GRRTNYTLHV IEMKHDGIRK IGYWNEDDKF VPAATDAQAG GDNSSVQNRT YIVTTILEDP YVMLKKNANQ FEGNDRYEGY CVELAAEIAK HVGYSYRLEI VSDGKYGARD PDTKAWNGMV GELVYGRADV AVAPLTITLV REEVIDFSKP FMSLGISIMI KKPQKSKPGV FSFLDPLA. It is sometimes possible for the material contained within the vial of "Glutamate receptor 1 (GRIA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.