Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113486_SDS_PAGE15.jpg SDS-PAGE

Glutathione S-transferase alpha-1 Recombinant Protein | Gsta1 recombinant protein

Recombinant Rat Glutathione S-transferase alpha-1

Gene Names
Gsta2; Gsta1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase alpha-1; N/A; Recombinant Rat Glutathione S-transferase alpha-1; GST 1-1; GST 1a-1a; GST A1-1; GST B; Glutathione S-transferase Ya-1; GST Ya1; Ligandin; Gsta1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-222aa; Full Length of Mature Protein
Sequence
SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113486_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Gsta1 recombinant protein
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
References
The nucleotide sequence of a rat liver glutathione S-transferase subunit cDNA clone.Lai H.-C.J., Li N.-Q., Weiss M.J., Reddy C.C., Tu C.-P.D.J. Biol. Chem. 259:5536-5542(1984) Rat glutathione S-transferase. Cloning of double-stranded cDNA and induction of its mRNA.Kalinyak J.E., Taylor J.M.J. Biol. Chem. 257:523-530(1982) Localization of the C-terminus of rat glutathione S-transferase A1-1 crystal structure of mutants W21F and W21F/F220Y.Adman E.T., Le Trong I., Stenkamp R.E., Nieslanik B.S., Dietze E.C., Tai G., Ibarra C., Atkins W.M.3.0.CO;2-%23>Proteins 42:192-200(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.5 kDa
NCBI Official Full Name
glutathione S-transferase alpha-1
NCBI Official Synonym Full Names
glutathione S-transferase alpha 2
NCBI Official Symbol
Gsta2
NCBI Official Synonym Symbols
Gsta1
NCBI Protein Information
glutathione S-transferase alpha-1
UniProt Protein Name
Glutathione S-transferase alpha-1
UniProt Gene Name
Gsta1
UniProt Synonym Gene Names
GST Ya1
UniProt Entry Name
GSTA1_RAT

Similar Products

Product Notes

The Gsta1 gsta1 (Catalog #AAA113486) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-222aa; Full Length of Mature Protein. The amino acid sequence is listed below: SGKPVLHYFN ARGRMECIRW LLAAAGVEFD EKFIQSPEDL EKLKKDGNLM FDQVPMVEID GMKLAQTRAI LNYIATKYDL YGKDMKERAL IDMYTEGILD LTEMIMQLVI CPPDQKEAKT ALAKDRTKNR YLPAFEKVLK SHGQDYLVGN RLTRVDIHLL ELLLYVEEFD ASLLTSFPLL KAFKSRISSL PNVKKFLQPG SQRKLPVDAK QIEEARKIFK F. It is sometimes possible for the material contained within the vial of "Glutathione S-transferase alpha-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.