Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115385_SDS_PAGE15.jpg SDS-PAGE

Histone H1.0-A (h1f0-a) Recombinant Protein | h1f0-a recombinant protein

Recombinant Xenopus laevis Histone H1.0-A (h1f0-a)

Gene Names
h1f0-a; h10; h1f0; h1fv; h1(0)-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone H1.0-A (h1f0-a); N/A; Recombinant Xenopus laevis Histone H1.0-A (h1f0-a); Histone H1.0-A; H1-SB; H1E; Histone H1(0)-1; Histone H5B; XlH5B; h1f0-a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-194aa; Full Length
Sequence
MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK
Sequence Length
194
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA115385_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for h1f0-a recombinant protein
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity).
Product Categories/Family for h1f0-a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
histone H1.0-A
NCBI Official Synonym Full Names
H1 histone family, member 0<
NCBI Official Symbol
h1f0-a
NCBI Official Synonym Symbols
h10; h1f0; h1fv; h1(0)-1
NCBI Protein Information
histone H1.0-A; H1E; H1-SB; xlH5B; histone H5B; histone H1(0)-1
UniProt Protein Name
Histone H1.0-A
UniProt Gene Name
h1f0-a
UniProt Entry Name
H10A_XENLA

Similar Products

Product Notes

The h1f0-a h1f0-a (Catalog #AAA115385) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194aa; Full Length. The amino acid sequence is listed below: MTENSAPAAK PRRSKASKKS TDHPKYSDMI LDAVQAEKSR SGSSRQSIQK YIKNNYTVGE NADSQIKLSI KRLVTSGTLK QTKGVGASGS FRLAKADEVK KPAKKPKKEI KKAVSPKKAA KPKKAAKSPA KAKKPKVAEK KVKKAPKKKP APSPRKAKKT KTVRAKPVWA SKAKKAKPSK PKAKASPKKS GRKK. It is sometimes possible for the material contained within the vial of "Histone H1.0-A (h1f0-a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.