SDS-PAGE
Heart-and neural crest derivatives-expressed protein 2 (HAND2) Recombinant Protein | HAND2 recombinant protein
Recombinant Human Heart-and neural crest derivatives-expressed protein 2 (HAND2)
Gene Names
HAND2; Hed; dHand; DHAND2; Thing2; bHLHa26
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heart-and neural crest derivatives-expressed protein 2 (HAND2); N/A; Recombinant Human Heart-and neural crest derivatives-expressed protein 2 (HAND2); Heart- and neural crest derivatives-expressed protein 2; Class A basic helix-loop-helix protein 26; bHLHa26; Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; dHAND; HAND2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-180aa; Full Length of of Isoform 2
Sequence
MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for HAND2 recombinant protein
Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'
Product Categories/Family for HAND2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47.3 kDa
NCBI Official Full Name
heart- and neural crest derivatives-expressed protein 2
NCBI Official Synonym Full Names
heart and neural crest derivatives expressed 2
NCBI Official Symbol
HAND2
NCBI Official Synonym Symbols
Hed; dHand; DHAND2; Thing2; bHLHa26
NCBI Protein Information
heart- and neural crest derivatives-expressed protein 2; class A basic helix-loop-helix protein 26; basic helix-loop-helix transcription factor HAND2; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2
UniProt Protein Name
Heart- and neural crest derivatives-expressed protein 2
UniProt Gene Name
HAND2
UniProt Synonym Gene Names
BHLHA26; DHAND; bHLHa26; dHAND
UniProt Entry Name
HAND2_HUMAN
Similar Products
Product Notes
The HAND2 hand2 (Catalog #AAA113828) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-180aa; Full Length of of Isoform 2. The amino acid sequence is listed below: MSLVGGFPHH PVVHHEGYPF AAAAAASRCS HEENPYFHGW LIGHPEMSPP DYSMALSYSP EYASGTANRK ERRRTQSINS AFAELRECIP NVPADTKLSK IKTLRLATSY IAYLMDLLAK DDQNGEAEAF KAEIKKTDVK EEKRKKELNE ILKSTVSSND KKTKGRTGWP QHVWALELKQ. It is sometimes possible for the material contained within the vial of "Heart-and neural crest derivatives-expressed protein 2 (HAND2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.