Histone deacetylase 4 (HDAC4) Recombinant Protein | HDAC4 recombinant protein
Recombinant Human Histone deacetylase 4 (HDAC4) , partial
Gene Names
HDAC4; HD4; AHO3; BDMR; HDACA; HA6116; HDAC-4; HDAC-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone deacetylase 4 (HDAC4); N/A; Recombinant Human Histone deacetylase 4 (HDAC4) , partial; HDAC4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227aa; partial;
Sequence
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNH
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HDAC4 recombinant protein
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation
deacetylation alters chromosome structure and affects transcription factor access to DNA. This protein belongs to class II of the histone deacetylase
acuc
apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.
deacetylation alters chromosome structure and affects transcription factor access to DNA. This protein belongs to class II of the histone deacetylase
acuc
apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
106,367 Da
NCBI Official Full Name
histone deacetylase 4
NCBI Official Synonym Full Names
histone deacetylase 4
NCBI Official Symbol
HDAC4
NCBI Official Synonym Symbols
HD4; AHO3; BDMR; HDACA; HA6116; HDAC-4; HDAC-A
NCBI Protein Information
histone deacetylase 4
UniProt Protein Name
Histone deacetylase 4
UniProt Gene Name
HDAC4
UniProt Synonym Gene Names
KIAA0288; HD4
Similar Products
Product Notes
The HDAC4 hdac4 (Catalog #AAA113432) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227aa; partial;. The amino acid sequence is listed below: MSSQSHPDGL SGRDQPVELL NPARVNHMPS TVDVATALPL QVAPSAVPMD LRLDHQFSLP VAEPALREQQ LQQELLALKQ KQQIQRQILI AEFQRQHEQL SRQHEAQLHE HIKQQQEMLA MKHQQELLEH QRKLERHRQE QELEKQHREQ KLQQLKNKEK GKESAVASTE VKMKLQEFVL NKKKALAHRN LNHCISSDPR YWYGKTQHSS LDQSSPPQSG VSTSYNH. It is sometimes possible for the material contained within the vial of "Histone deacetylase 4 (HDAC4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.