Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116202_SDS_PAGE15.jpg SDS-PAGE

Histone deacetylase 7 Recombinant Protein | HDAC7 recombinant protein

Recombinant Human Histone deacetylase 7

Average rating 0.0
No ratings yet
Gene Names
HDAC7; HD7; HD7A; HDAC7A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone deacetylase 7; N/A; Recombinant Human Histone deacetylase 7; Histone deacetylase 7A; HD7a; HDAC7 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
4-203. Partial
Sequence
PGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116202_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for HDAC7 recombinant protein
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Positively regulates the transcriptional repressor activity of FOXP3.
Product Categories/Family for HDAC7 recombinant protein
References
A novel class II HDAC is associated with the transcriptional homeodomain repressor CCAAT displacement protein.Li S., Fischle W., Verdin E., Walsh M.J. Genomic organization of the human histone deacetylase 7 gene.Petrie K., Zelent A.Homo sapiens histone deacetylase 7A (HDAC7A)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26 kDa
NCBI Official Full Name
histone deacetylase 7 isoform d
NCBI Official Synonym Full Names
histone deacetylase 7
NCBI Official Symbol
HDAC7
NCBI Official Synonym Symbols
HD7; HD7A; HDAC7A
NCBI Protein Information
histone deacetylase 7
UniProt Protein Name
Histone deacetylase 7
UniProt Gene Name
HDAC7
UniProt Synonym Gene Names
HDAC7A; HD7; HD7a
UniProt Entry Name
HDAC7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HDAC7 hdac7 (Catalog #AAA116202) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-203. Partial. The amino acid sequence is listed below: PGADGTQVSP GAHYCSPTGA GCPRPCADTP GPQPQPMDLR VGQRPPVEPP PEPTLLALQR PQRLHHHLFL AGLQQQRSVE PMRLSMDTPM PELQVGPQEQ ELRQLLHKDK SKRSAVASSV VKQKLAEVIL KKQQAALERT VHPNSPGIPY RTLEPLETEG ATRSMLSSFL PPVPSLPSDP PEHFPLRKTV SEPNLKLRYK. It is sometimes possible for the material contained within the vial of "Histone deacetylase 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.