Histone H2B type 1-M (Hist1h2bm) Recombinant Protein | Hist1h2bm recombinant protein
Recombinant Mouse Histone H2B type 1-M (Hist1h2bm)
Gene Names
Hist1h2bm; H2b-291b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone H2B type 1-M (Hist1h2bm); N/A; Recombinant Mouse Histone H2B type 1-M (Hist1h2bm); H2B 291B; Hist1h2bm recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-126. Full length of the mature protein.
Sequence
PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Sequence Length
126
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Hist1h2bm recombinant protein
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
References
Mouse histone H2A and H2B genes four functional genes and a pseudogene undergoing gene conversion with a closely linked functional gene.Liu T.-J., Liu L., Marzluff W.F.Nucleic Acids Res. 15:3023-3039(1987) The human and mouse replication-dependent histone genes.Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J.Genomics 80:487-498(2002) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Phosphorylation of histone H2B at DNA double-strand breaks.Fernandez-Capetillo O., Allis C.D., Nussenzweig A.J. Exp. Med. 199:1671-1677(2004) Histone modifications associated with somatic hypermutation.Odegard V.H., Kim S.T., Anderson S.M., Shlomchik M.J., Schatz D.G.Immunity 23:101-110(2005) Signaling kinase AMPK activates stress-promoted transcription via histone H2B phosphorylation.Bungard D., Fuerth B.J., Zeng P.Y., Faubert B., Maas N.L., Viollet B., Carling D., Thompson C.B., Jones R.G., Berger S.L.Science 329:1201-1205(2010) Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.Tan M., Luo H., Lee S., Jin F., Yang J.S., Montellier E., Buchou T., Cheng Z., Rousseaux S., Rajagopal N., Lu Z., Ye Z., Zhu Q., Wysocka J., Ye Y., Khochbin S., Ren B., Zhao Y.Cell 146:1016-1028(2011) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17.8 kDa
NCBI Official Full Name
histone H2B type 1-M
NCBI Official Synonym Full Names
histone cluster 1, H2bm
NCBI Official Symbol
Hist1h2bm
NCBI Official Synonym Symbols
H2b-291b
NCBI Protein Information
histone H2B type 1-M
UniProt Protein Name
Histone H2B type 1-M
UniProt Gene Name
Hist1h2bm
UniProt Entry Name
H2B1M_MOUSE
Similar Products
Product Notes
The Hist1h2bm hist1h2bm (Catalog #AAA113803) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-126. Full length of the mature protein. The amino acid sequence is listed below: PEPTKSAPAP KKGSKKAVTK AQKKDGKKRK RSRKESYSVY VYKVLKQVHP DTGISSKAMG IMNSFVNDIF ERIAGEASRL AHYNKRSTIT SREIQTAVRL LLPGELAKHA VSEGTKAVTK YTSSK. It is sometimes possible for the material contained within the vial of "Histone H2B type 1-M (Hist1h2bm), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
