Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA190338_SDS_PAGE15.jpg SDS-PAGE

Histone-lysine N-methyltransferase EZH2 (EZH2) Recombinant Protein | EZH2 recombinant protein

Recombinant Human Histone-lysine N-methyltransferase EZH2 (EZH2) Protein

Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Histone-lysine N-methyltransferase EZH2 (EZH2); N/A; Recombinant Human Histone-lysine N-methyltransferase EZH2 (EZH2) Protein; ENX-1; KMT6; KMT6A; Enhancer Of Zeste Homolog 2; Lysine N-methyltransferase 6.; EZH2 recombinant protein
Ordering
Host
E. coli AA 446-751 (Q15910).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
58 mM Na2HPO4, 17 mM Na2HPO4, 68 mM NaCl, pH 7.0, with 15% glycerol.
Concentration
0.5 mg/mL (varies by lot)
Sequence
RVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
Species
Human
Source
Human
Protein residues
with 6*His-tag.
Volume
0.2 mL
Usage
EZH2 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**

Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.

SDS-PAGE

product-image-AAA190338_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for EZH2 recombinant protein
EZH2 encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. EZH2 acts mainly as a gene silencer; it performs this role by the addition of three methyl groups to Lysine 27 of histone 3, a modification leading to chromatin condensation. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein (XNP). This protein may play a role in the hematopoietic and central nervous systems. Two transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
Predicted MW: 42 kDa
Observed MW: 42 kDa

Similar Products

Product Notes

The EZH2 (Catalog #AAA190338) is a Recombinant Protein produced from E. coli AA 446-751 (Q15910). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RVLIGTYYDN FCAIARLIGT KTCRQVYEFR VKESSIIAPA PAEDVDTPPR KKKRKHRLWA AHCRKIQLKK DGSSNHVYNY QPCDHPRQPC DSSCPCVIAQ NFCEKFCQCS SECQNRFPGC RCKAQCNTKQ CPCYLAVREC DPDLCLTCGA ADHWDSKNVS CKNCSIQRGS KKHLLLAPSD VAGWGIFIKD PVQKNEFISE YCGEIISQDE ADRRGKVYDK YMCSFLFNLN NDFVVDATRK GNKIRFANHS VNPNCYAKVM MVNGDHRIGI FAKRAIQTGE ELFFDYRYSQ ADALKYVGIE REMEIP. It is sometimes possible for the material contained within the vial of "Histone-lysine N-methyltransferase EZH2 (EZH2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.