HIV-1 pol Integrase Recombinant Protein
Recombinant HIV-1 pol Integrase
Applications
Western Blot, ELISA
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
HIV-1 pol Integrase; N/A; Recombinant HIV-1 pol Integrase; HIV-1 Integrase; HIV-1 Integrase Recombinant; HIV-1 pol Integrase recombinant protein
Host
E Coli
Specificity
Immunoreactive with all sera of HIV-1 infected individuals.
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.
Sterile filtered colorless clear solution.
Sterile filtered colorless clear solution.
Concentration
4.55mg/1ml (varies by lot)
Sequence
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Applicable Applications for HIV-1 pol Integrase recombinant protein
WB (Western Blot), ELISA
Related Product Information for HIV-1 pol Integrase recombinant protein
Description: The E Coli derived 36 kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 immunodominant regions from the pol protein (intergrase) and fused with a six histidines tag.
Introduction: Integrase is an enzyme produced by the HIV which enables its genetic material to be integrated into the DNA of the infected cell and is a key component in the pre-integration complex. HIV integrase contains 3 domains, an N-terminal HH-CC zinc fingerdomainwhich is partially responsible for multimerization, a central catalytic domain and a C-terminal domain. Both Central catalytic domain and C-terminal domains have been shown to bind both viral and cellular DNA. No crystal structure data exists with Integrase bound to its DNA substrates. HIV-1 integrase functions as a dimeror a tetramer. Additionally, several host cellular proteins interact with integrase and may facilitate the integration process.
Introduction: Integrase is an enzyme produced by the HIV which enables its genetic material to be integrated into the DNA of the infected cell and is a key component in the pre-integration complex. HIV integrase contains 3 domains, an N-terminal HH-CC zinc fingerdomainwhich is partially responsible for multimerization, a central catalytic domain and a C-terminal domain. Both Central catalytic domain and C-terminal domains have been shown to bind both viral and cellular DNA. No crystal structure data exists with Integrase bound to its DNA substrates. HIV-1 integrase functions as a dimeror a tetramer. Additionally, several host cellular proteins interact with integrase and may facilitate the integration process.
Product Categories/Family for HIV-1 pol Integrase recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HIV-1 pol Integrase (Catalog #AAA38335) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HIV-1 pol Integrase can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the HIV-1 pol Integrase for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: mfldgidkaq eehekyhsnw ramasdfnlp pvvakeivas cdkcqlkgea mhgqvdcspg iwqldcthle gkvilvavhv asgyieaevi paetgqetay filklagrwp vktihtdngs nftsttvkaa cwwagikqef gipynpqsqg viesmnkelk kiigqvrdqa ehlktavqma vfihnfkrkg giggysager ivdiiatdiq tkelqkqitk iqnfrvyyrd srdplwkgpa kllwkgegav viqdnsdikv vprrkakiir dygkqmagdd cvasrqdedh hhhhh. It is sometimes possible for the material contained within the vial of "HIV-1 pol Integrase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.