HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1) Recombinant Protein | HLA-DRB1 recombinant protein
Recombinant Human HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1), partial
Gene Names
HLA-DRB1; SS1; DRB1; HLA-DRB; HLA-DR1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1); N/A; Recombinant Human HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1), partial; HLA-DRB1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-266. Partial
Sequence
DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,120 Da
NCBI Official Full Name
major histocompatibility complex, class II, DR beta 1
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DR beta 1
NCBI Official Symbol
HLA-DRB1
NCBI Official Synonym Symbols
SS1; DRB1; HLA-DRB; HLA-DR1B
NCBI Protein Information
major histocompatibility complex, class II, DR beta 1
UniProt Protein Name
HLA class II histocompatibility antigen, DRB1-3 chain
UniProt Gene Name
HLA-DRB1
Similar Products
Product Notes
The HLA-DRB1 hla-drb1 (Catalog #AAA115054) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-266. Partial. The amino acid sequence is listed below: DTRPRFLEYS TSECHFFNGT ERVRYLDRYF HNQEENVRFD SDVGEFRAVT ELGRPDAEYW NSQKDLLEQK RGRVDNYCRH NYGVVESFTV QRRVHPKVTV YPSKTQPLQH HNLLVCSVSG FYPGSIEVRW FRNGQEEKTG VVSTGLIHNG DWTFQTLVML ETVPRSGEVY TCQVEHPSVT SPLTVEWRAR SESAQSKMLS GVGGFVLGLL FLGAGLFIYF RNQKGHSGLQ PRGFLS. It is sometimes possible for the material contained within the vial of "HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.