HLA class I histocompatibility antigen, alpha chain E (HLA-E) Recombinant Protein | HLA-E recombinant protein
Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial
Gene Names
HLA-E; QA1; HLA-6.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class I histocompatibility antigen, alpha chain E (HLA-E); N/A; Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial; MHC class I antigen E; HLA-E recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-305aa; Extracellular Domain (Old version, reference link: https://www.uniprot.org/uniprot/P13747.fasta?version=188)
Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for HLA-E recombinant protein
Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.
Product Categories/Family for HLA-E recombinant protein
References
Isolation and nucleotide sequence of a cDNA clone encoding a novel HLA class I gene.Mizuno S., Trapani J.A., Koller B.H., Dupont B., Yang S.Y.J. Immunol. 140:4024-4030(1988)
Cell surface expression of HLA-E
interaction with human beta-2 microglobulin and allelic differences.Ulbrecht M., Courturier A., Martinozzi S., Pla M., Srivastava R., Peterson P.A., Weiss E.H.3.0.CO;2-6>Eur. J. Immunol. 29:537-547(1999)
HLA-E, F, and G polymorphism
genomic sequence defines new variation spanning the nonclassical class I genes.Ishitani A., Miki A., Williams L.M., Moore Y., Geraghty D.E.Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.
HLA-E. A novel HLA class I gene expressed in resting T lymphocytes.Koller B.H., Geraghty D.E., Shimizu Y., Demars R., Orr H.T.J. Immunol. 141:897-904(1988)
Ulbrecht M.A new variant of HLA-E*010303 with three synonymous mutations.He X., Xu L., Liu Y., Zeng Y.Cloning of HLA-E cDNA from activated peripheral leukocytes.He X., Xu L., Liu Y., Zeng Y.Polymorphism in the human class I MHC locus HLA-E in Japanese.Ohya K., Kondo K., Mizuno S.Immunogenetics 32:205-209(1990)
Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009)
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Structural features impose tight peptide binding specificity in the nonclassical MHC molecule HLA-E.O'Callaghan C.A., Tormo J., Willcox B.E., Braud V.M., Jakobsen B.K., Stuart D.I., McMichael A.J., Bell J.I., Jones E.Y.Mol. Cell 1:531-541(1998)
Definitive high resolution typing of HLA-E allelic polymorphisms
identifying potential errors in existing allele data.Grimsley C., Kawasaki A., Gassner C., Sageshima N., Nose Y., Hatake K., Geraghty D.E., Ishitani A.Tissue Antigens 60:206-212(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.7 kDa
NCBI Official Full Name
HLA class I histocompatibility antigen, alpha chain E
NCBI Official Synonym Full Names
major histocompatibility complex, class I, E
NCBI Official Symbol
HLA-E
NCBI Official Synonym Symbols
QA1; HLA-6.2
NCBI Protein Information
HLA class I histocompatibility antigen, alpha chain E
UniProt Protein Name
HLA class I histocompatibility antigen, alpha chain E
UniProt Gene Name
HLA-E
UniProt Synonym Gene Names
HLA-6.2; HLAE
UniProt Entry Name
HLAE_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HLA-E hla-e (Catalog #AAA18695) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-305aa; Extracellular Domain (Old version, reference link: https://www.uniprot.org/uniprot/P13747.fasta?version=188). The amino acid sequence is listed below: GSHSLKYFHT SVSRPGRGEP RFISVGYVDD TQFVRFDNDA ASPRMVPRAP WMEQEGSEYW DRETRSARDT AQIFRVNLRT LRGYYNQSEA GSHTLQWMHG CELGPDRRFL RGYEQFAYDG KDYLTLNEDL RSWTAVDTAA QISEQKSNDA SEAEHQRAYL EDTCVEWLHK YLEKGKETLL HLEPPKTHVT HHPISDHEAT LRCWALGFYP AEITLTWQQD GEGHTQDTEL VETRPAGDGT FQKWAAVVVP SGEEQRYTCH VQHEGLPEPV TLRWKPASQP TIPI . It is sometimes possible for the material contained within the vial of "HLA class I histocompatibility antigen, alpha chain E (HLA-E), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
