Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA15926_SDS_PAGE.png SDS-PAGE

HLA class I histocompatibility antigen, alpha chain G (HLA-G) Recombinant Protein | HLA-G recombinant protein

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class I histocompatibility antigen, alpha chain G (HLA-G); N/A; Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G); HLA G antigen; MHC class I antigen G; HLA-G recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-338aa; Full Length of Mature Protein
Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA15926_SDS_PAGE.png SDS-PAGE
Related Product Information for HLA-G recombinant protein
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Product Categories/Family for HLA-G recombinant protein
References
The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern of expression.Shukla H., Swaroop A., Srivastava R., Weissman S.M.Nucleic Acids Res. 18:2189-2189(1990) A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment.Geraghty D.E., Koller B.H., Orr H.T.Proc. Natl. Acad. Sci. U.S.A. 84:9145-9149(1987) Ishitani A., Geraghty D.E. A 356-Kb sequence of the subtelomeric part of the MHC class I region.Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M., Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F.DNA Seq. 10:263-299(1999) Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002) Crystal structure of HLA-G a nonclassical MHC class I molecule expressed at the fetal-maternal interface.Clements C.S., Kjer-Nielsen L., Kostenko L., Hoare H.L., Dunstone M.A., Moses E., Freed K., Brooks A.G., Rossjohn J., McCluskey J.Proc. Natl. Acad. Sci. U.S.A. 102:3360-3365(2005) Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.6 kDa
NCBI Official Full Name
HLA class I histocompatibility antigen, alpha chain G
UniProt Protein Name
HLA class I histocompatibility antigen, alpha chain G
UniProt Gene Name
HLA-G
UniProt Synonym Gene Names
HLA-6.0; HLAG
UniProt Entry Name
HLAG_HUMAN

Similar Products

Product Notes

The HLA-G hla-g (Catalog #AAA15926) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-338aa; Full Length of Mature Protein. The amino acid sequence is listed below: GSHSMRYFSA AVSRPGRGEP RFIAMGYVDD TQFVRFDSDS ACPRMEPRAP WVEQEGPEYW EEETRNTKAH AQTDRMNLQT LRGYYNQSEA SSHTLQWMIG CDLGSDGRLL RGYEQYAYDG KDYLALNEDL RSWTAADTAA QISKRKCEAA NVAEQRRAYL EGTCVEWLHR YLENGKEMLQ RADPPKTHVT HHPVFDYEAT LRCWALGFYP AEIILTWQRD GEDQTQDVEL VETRPAGDGT FQKWAAVVVP SGEEQRYTCH VQHEGLPEPL MLRWKQSSLP TIPIMGIVAG LVVLAAVVTG AAVAAVLWRK KSSD . It is sometimes possible for the material contained within the vial of "HLA class I histocompatibility antigen, alpha chain G (HLA-G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.