Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC) Recombinant Protein | HNRNPC recombinant protein
Recombinant Human Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC)
Gene Names
HNRNPC; C1; C2; HNRNP; HNRPC; SNRPC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC); N/A; Recombinant Human Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC); HNRNPC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-306, Full length protein
Sequence
ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Sequence Length
305
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HNRNPC recombinant protein
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,822 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoproteins C1/C2 isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein C (C1/C2)
NCBI Official Symbol
HNRNPC
NCBI Official Synonym Symbols
C1; C2; HNRNP; HNRPC; SNRPC
NCBI Protein Information
heterogeneous nuclear ribonucleoproteins C1/C2
UniProt Protein Name
Heterogeneous nuclear ribonucleoproteins C1/C2
UniProt Gene Name
HNRNPC
UniProt Synonym Gene Names
HNRPC; hnRNP C1/C2
Similar Products
Product Notes
The HNRNPC hnrnpc (Catalog #AAA114084) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-306, Full length protein. The amino acid sequence is listed below: ASNVTNKTDP RSMNSRVFIG NLNTLVVKKS DVEAIFSKYG KIVGCSVHKG FAFVQYVNER NARAAVAGED GRMIAGQVLD INLAAEPKVN RGKAGVKRSA AEMYGSVTEH PSPSPLLSSS FDLDYDFQRD YYDRMYSYPA RVPPPPPIAR AVVPSKRQRV SGNTSRRGKS GFNSKSGQRG SSKSGKLKGD DLQAIKKELT QIKQKVDSLL ENLEKIEKEQ SKQAVEMKND KSEEEQSSSS VKKDETNVKM ESEGGADDSA EEGDLLDDDD NEDRGDDQLE LIKDDEKEAE EGEDDRDSAN GEDDS. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.