Huntingtin (Htt) Recombinant Protein | Htt recombinant protein
Recombinant Mouse Huntingtin (Htt) , partial
Gene Names
Htt; Hd; Hdh; IT15; AI256365; C430023I11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Huntingtin (Htt); N/A; Recombinant Mouse Huntingtin (Htt) , partial; Htt recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
427-660. Partial
Sequence
EEALEDDSESRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAP
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Htt recombinant protein
Huntingtin is a disease gene linked to Huntington s disease, a neurodegenerative disorder characterized by loss of striatal neurons. This is thought to be caused by an expanded, unstable trinucleotide repeat in the huntingtin gene, which translates as a polyglutamine repeat in the protein product. A fairly broad range in the number of trinucleotide repeats has been identified in normal controls, and repeat numbers in excess of 40 have been described as pathological. The huntingtin locus is large, spanning 180 kb and consisting of 67 exons. The huntingtin gene is widely expressed and is required for normal development. It is expressed as 2 alternatively polyadenylated forms displaying different relative abundance in various fetal and adult tissues. The larger transcript is approximately 13.7 kb and is expressed predominantly in adult and fetal brain whereas the smaller transcript of approximately 10.3 kb is more widely expressed. The genetic defect leading to Huntington s disease may not necessarily eliminate transcription, but may confer a new property on the mRNA or alter the function of the protein. One candidate is the huntingtin-associated protein-1, highly expressed in brain, which has increased affinity for huntingtin protein with expanded polyglutamine repeats. This gene contains an upstream open reading frame in the 5 UTR that inhibits expression of the huntingtin gene product through translational repression.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
290,701 Da
NCBI Official Full Name
Huntingtin
NCBI Official Synonym Full Names
huntingtin
NCBI Official Symbol
Htt
NCBI Official Synonym Symbols
Hd; Hdh; IT15; AI256365; C430023I11Rik
NCBI Protein Information
huntingtin
UniProt Protein Name
Huntingtin
UniProt Gene Name
Htt
UniProt Synonym Gene Names
Hd; Hdh; HD protein homolog
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Htt htt (Catalog #AAA113818) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 427-660. Partial. The amino acid sequence is listed below: EEALEDDSES RSDVSSSAFA ASVKSEIGGE LAASSGVSTP GSVGHDIITE QPRSQHTLQA DSVDLSGCDL TSAATDGDEE DILSHSSSQF SAVPSDPAMD LNDGTQASSP ISDSSQTTTE GPDSAVTPSD SSEIVLDGAD SQYLGMQIGQ PQEDDEEGAA GVLSGEVSDV FRNSSLALQQ AHLLERMGHS RQPSDSSIDK YVTRDEVAEA SDPESKPCRI KGDIGQPNDD DSAP. It is sometimes possible for the material contained within the vial of "Huntingtin (Htt), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.