PVR blocking peptide
PVR Peptide - N-terminal region
Gene Names
PVR; PVS; HVED; CD155; NECL5; TAGE4; Necl-5
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Synonyms
PVR; N/A; PVR Peptide - N-terminal region; PVR blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
FHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVT
Sequence Length
417
Applicable Applications for PVR blocking peptide
WB (Western Blot), IHC (Immunohistochemistry)
Partner proteins
VTN,AP1M2,CD226,CD96,DYNLT3,PVR,PVRL1,PVRL3,VTN,AP1M2,CD226,DYNLT1,PVRL3,VTN
Quality control
The peptide is characterized by mass spectroscopy
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PVR blocking peptide
Target Description: The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
This is a synthetic peptide designed for use in combination with anti-PVR Antibody (MBS3215850). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
This is a synthetic peptide designed for use in combination with anti-PVR Antibody (MBS3215850). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product Categories/Family for PVR blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
poliovirus receptor isoform alpha
NCBI Official Synonym Full Names
poliovirus receptor
NCBI Official Symbol
PVR
NCBI Official Synonym Symbols
PVS; HVED; CD155; NECL5; TAGE4; Necl-5
NCBI Protein Information
poliovirus receptor
UniProt Protein Name
Poliovirus receptor
UniProt Gene Name
PVR
UniProt Synonym Gene Names
PVS; NECL-5
UniProt Entry Name
PVR_HUMAN
Similar Products
Product Notes
The PVR pvr (Catalog #AAA201846) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PVR Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PVR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PVR pvr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FHQTQGPSYS ESKRLEFVAA RLGAELRNAS LRMFGLRVED EGNYTCLFVT. It is sometimes possible for the material contained within the vial of "PVR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.