Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283389_AD13.jpg Application Data (Recombinant Human IFN-alpha G/IFNA5 was measured in a cell cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 3.27?13.06 ng/mL, corresponding to a specific activity of 7.66×10<sup>4</sup>~3.06×10<sup>5</sup> units/mg.)

IFN-alpha G/IFNA5 Recombinant Protein | IFNA5 recombinant protein

Recombinant Human IFN-alpha G/IFNA5 Protein

Synonyms
IFN-alpha G/IFNA5; N/A; Recombinant Human IFN-alpha G/IFNA5 Protein; Ifa5; IFNA5; IFNalpha G; IFN-alpha G; IFN-alpha-5; IFN-alphaG; INFA5; interferon alpha-5; Interferon alpha-61; Interferon alpha-G; interferon, alpha 5; LeIF G; IFNA5 recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Species
Human
Tag
C-His
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 3.27?13.06ng/mL, corresponding to a specific activity of 7.66×104~3.06×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human IFN-alpha G/IFNA5 was measured in a cell cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 3.27?13.06 ng/mL, corresponding to a specific activity of 7.66×10<sup>4</sup>~3.06×10<sup>5</sup> units/mg.)

product-image-AAA283389_AD13.jpg Application Data (Recombinant Human IFN-alpha G/IFNA5 was measured in a cell cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 3.27?13.06 ng/mL, corresponding to a specific activity of 7.66×10<sup>4</sup>~3.06×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Human IFN-alpha G/IFNA5 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 KD.)

product-image-AAA283389_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human IFN-alpha G/IFNA5 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 KD.)
Related Product Information for IFNA5 recombinant protein
Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.
Product Categories/Family for IFNA5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interferon alpha-5
UniProt Gene Name
IFNA5
UniProt Synonym Gene Names
IFN-alpha-5; LeIF G
UniProt Entry Name
IFNA5_HUMAN

Similar Products

Product Notes

The IFNA5 ifna5 (Catalog #AAA283389) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LGCDLPQTHS LSNRRTLMIM AQMGRISPFS CLKDRHDFGF PQEEFDGNQF QKAQAISVLH EMIQQTFNLF STKDSSATWD ETLLDKFYTE LYQQLNDLEA CMMQEVGVED TPLMNVDSIL TVRKYFQRIT LYLTEKKYSP CAWEVVRAEI MRSFSLSANL QERLRRKE. It is sometimes possible for the material contained within the vial of "IFN-alpha G/IFNA5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.