Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18629_SDS_PAGE.jpg SDS-PAGE

Interferon tau-1 Recombinant Protein | IFNT1 recombinant protein

Recombinant Bovine Interferon tau-1

Average rating 0.0
No ratings yet
Gene Names
IFNT2; IFNT; TP-1; IFNT1; IFN-tau-c2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon tau-1; N/A; Recombinant Bovine Interferon tau-1; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1Trophoblastin; IFNT1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-195aa; Full Length of Mature Protein
Sequence
CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18629_SDS_PAGE.jpg SDS-PAGE
Related Product Information for IFNT1 recombinant protein
Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.
References
Molecular cloning and characterization of complementary deoxyribonucleic acids corresponding to bovine trophoblast protein-1 a comparison with ovine trophoblast protein-1 and bovine interferon-alpha II.Imakawa K., Hansen T.R., Malathy P.-V., Anthony R.V., Polites H.G., Marotti K.R., Roberts R.M.Mol. Endocrinol. 3:127-139(1989) Structure of an interferon-alpha 2 gene expressed in the bovine conceptus early in gestation.Stewart H.J., McCann S.H., Flint A.P.F.J. Mol. Endocrinol. 4:275-282(1990) The genes for the trophoblast interferons and the related interferon-alpha II possess distinct 5'-promoter and 3'-flanking sequences.Hansen T.R., Leaman D.W., Cross J.C., Mathialagan N., Bixby J.A., Roberts R.M.J. Biol. Chem. 266:3060-3067(1991) Stewart H.J. Roberts R.M.Cloning bovine interferon-tau genes and characterizing their transcriptional expression during early pregnancy.Chung Y.G., Seidel G.E. Jr.The expressed genes for bovine interferon-tau identification and expression during conceptus development.Larson S.F., Liu L., Winkelman G.L., Kubisch H.M., Bixby J.A., Roberts R.M., Ealy A.D.A three-dimensional model of interferon-tau.Senda T., Saitoh S., Mitsui Y., Li J., Roberts R.M.J. Interferon Cytokine Res. 15:1053-1060(1995) IFN-tau a novel subtype I IFN1. Structural characteristics, non-ubiquitous expression, structure-function relationships, a pregnancy hormonal embryonic signal and cross-species therapeutic potentialities.Martal J.L., Chene N.M., Huynh L.P., L'Haridon R.M., Reinaud P.B., Guillomot M.W., Charlier M.A., Charpigny S.Y.Biochimie 80:755-777(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.8 kDa
NCBI Official Full Name
interferon tau-2
NCBI Official Symbol
IFNT2
NCBI Official Synonym Symbols
IFNT; TP-1; IFNT1; IFN-tau-c2
NCBI Protein Information
interferon tau-2
UniProt Protein Name
Interferon tau-1
UniProt Gene Name
IFNT1
UniProt Synonym Gene Names
IFN-tau-1; TP-1
UniProt Entry Name
IFNT1_BOVIN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFNT1 ifnt1 (Catalog #AAA18629) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-195aa; Full Length of Mature Protein. The amino acid sequence is listed below: CYLSEDHMLG ARENLRLLAR MNRLSPHPCL QDRKDFGLPQ EMVEGNQLQK DQAISVLHEM LQQCFNLFYT EHSSAAWNTT LLEQLCTGLQ QQLEDLDACL GPVMGEKDSD MGRMGPILTV KKYFQGIHVY LKEKEYSDCA WEIIRVEMMR ALSSSTTLQK RLRKMGGDLN SL . It is sometimes possible for the material contained within the vial of "Interferon tau-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.