IGF1R recombinant protein
Recombinant Human Insulin-like growth factor 1 receptor (IGF1R) Protein
Gene Names
IGF1R; IGFR; CD221; IGFIR; JTK13
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
IGF1R; N/A; Recombinant Human Insulin-like growth factor 1 receptor (IGF1R) Protein; CD221; IGF1-R; IGFIR; JTK13.; IGF1R recombinant protein
Host
E. coli AA 763-931 (P08069).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
10 mM Tris-HCl, 1 mM EDTA, pH 8.0, with 50% glycerol.
Concentration
0.7 mg/mL (varies by lot)
Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
Source
Human
Protein Residues
with N-terminal 6×His-tag.
Endotoxin Level
Please contact us for more information.
Usage
IGF1R Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
Related Product Information for IGF1R recombinant protein
The Insulin-like Growth Factor 1 (IGF-1) Receptor is a transmembrane receptor that is activated by IGF-1 and by the related growth factor IGF-2. It belongs to the large class of tyrosine kinase receptors. This receptor mediates the effects of IGF-1, which is a polypeptide protein hormone similar in molecular structure to insulin. IGF-1 plays an important role in growth and continues to have anabolic effects in adults - meaning that it can induce hypertrophy of skeletal muscle and other target tissues. Mice lacking the IGF-1 receptor die late in development, and show a dramatic reduction in body mass, testifying to the strong growth promoting effect of this receptor. Mice carrying only one functional copy of igf1r are normal, but exhibit a ~15% decrease in body mass.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 23.4 kDa
Observed MW: 27 kDa
Observed MW: 27 kDa
NCBI Official Full Name
insulin-like growth factor 1 receptor isoform 1
NCBI Official Synonym Full Names
insulin like growth factor 1 receptor
NCBI Official Symbol
IGF1R
NCBI Official Synonym Symbols
IGFR; CD221; IGFIR; JTK13
NCBI Protein Information
insulin-like growth factor 1 receptor
UniProt Protein Name
Insulin-like growth factor 1 receptor
UniProt Gene Name
IGF1R
UniProt Synonym Gene Names
IGF-I receptor
UniProt Entry Name
IGF1R_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IGF1R igf1r (Catalog #AAA55953) is a Recombinant Protein produced from E. coli AA 763-931 (P08069). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: YNITDPEELE TEYPFFESRV DNKERTVISN LRPFTLYRID IHSCNHEAEK LGCSASNFVF ARTMPAEGAD DIPGPVTWEP RPENSIFLKW PEPENPNGLI LMYEIKYGSV EDQRECVSRQ EYRKYGGAKL NRLNPGNYTA RIQATSLSGN GSWTDPVFFY VQAKTGYE. It is sometimes possible for the material contained within the vial of "IGF1R, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
