Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113810_SDS_PAGE15.png SDS-PAGE

Insulin-like growth factor 1 receptor (IGF1R) Recombinant Protein | IGF1R recombinant protein

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

Gene Names
IGF1R; IGFR; CD221; IGFIR; JTK13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Insulin-like growth factor 1 receptor (IGF1R); N/A; Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial; Insulin-like growth factor I receptor ;IGF-I receptor; CD221; IGF1R recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
763-931aa; Partial
Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113810_SDS_PAGE15.png SDS-PAGE
Related Product Information for IGF1R recombinant protein
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1
2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT
PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT
PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2
SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase
signal transducer and activator of transcription pathway (JAK
STAT). Phosphorylation of JAK proteins can lead to phosphorylation
activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK
STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5
ASK1, which is able to directly associate with the IGF1R.When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
References
Discovery of 2,4-bis-arylamino-1,3-pyrimidines as insulin-like growth factor-1 receptor (IGF-1R) inhibitors.Buchanan J.L., Newcomb J.R., Carney D.P., Chaffee S.C., Chai L., Cupples R., Epstein L.F., Gallant P., Gu Y., Harmange J.C., Hodge K., Houk B.E., Huang X., Jona J., Joseph S., Jun H.T., Kumar R., Li C. , Lu J., Menges T., Morrison M.J., Novak P.M., van der Plas S., Radinsky R., Rose P.E., Sawant S., Sun J.R., Surapaneni S., Turci S.M., Xu K., Yanez E., Zhao H., Zhu X.Bioorg. Med. Chem. Lett. 21:2394-2399(2011)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.4 kDa
NCBI Official Full Name
insulin-like growth factor 1 receptor isoform 1
NCBI Official Synonym Full Names
insulin like growth factor 1 receptor
NCBI Official Symbol
IGF1R
NCBI Official Synonym Symbols
IGFR; CD221; IGFIR; JTK13
NCBI Protein Information
insulin-like growth factor 1 receptor
UniProt Protein Name
Insulin-like growth factor 1 receptor
UniProt Gene Name
IGF1R
UniProt Synonym Gene Names
IGF-I receptor

Similar Products

Product Notes

The IGF1R igf1r (Catalog #AAA113810) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 763-931aa; Partial. The amino acid sequence is listed below: YNITDPEELE TEYPFFESRV DNKERTVISN LRPFTLYRID IHSCNHEAEK LGCSASNFVF ARTMPAEGAD DIPGPVTWEP RPENSIFLKW PEPENPNGLI LMYEIKYGSQ VEDQRECVSR QEYRKYGGAK LNRLNPGNYT ARIQATSLSG NGSWTDPVFF YVQAKTGYE. It is sometimes possible for the material contained within the vial of "Insulin-like growth factor 1 receptor (IGF1R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.