Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283405_AD13.jpg Application Data (Recombinant Mouse IL12B?IL23A induce IL-17 secretion by mouse splenocytes. The ED<sub>50</sub> for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10<sup>6</sup>~3.44×10<sup>7</sup> units/mg.)

IL-23/IL-12B&IL-23A Recombinant Protein | IL12B&IL23A recombinant protein

Recombinant Mouse IL-23/IL-12B&IL-23A Protein

Average rating 0.0
No ratings yet
Synonyms
IL-23/IL-12B&IL-23A; N/A; Recombinant Mouse IL-23/IL-12B&IL-23A Protein; p40; Il-12b; Il12p40; Il-12p40;IL12B;p19; IL-23;il23A; IL12B&IL23A recombinant protein
Ordering
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&AVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Species
Mouse
Tag
N-His(IL-23a) & No tag(IL-12b)
Endotoxin
<0.1 EU/ug
Bio-Activity
Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED50 for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×106~3.44×107 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL12B?IL23A induce IL-17 secretion by mouse splenocytes. The ED<sub>50</sub> for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10<sup>6</sup>~3.44×10<sup>7</sup> units/mg.)

product-image-AAA283405_AD13.jpg Application Data (Recombinant Mouse IL12B?IL23A induce IL-17 secretion by mouse splenocytes. The ED<sub>50</sub> for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10<sup>6</sup>~3.44×10<sup>7</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse IL-23/IL-12B&IL-23A Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25(IL-23A) ,45-50(IL-12B)kDa and 65-75 kDa, respectively.)

product-image-AAA283405_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse IL-23/IL-12B&IL-23A Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25(IL-23A) ,45-50(IL-12B)kDa and 65-75 kDa, respectively.)
Related Product Information for IL12B&IL23A recombinant protein
Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12 (1-5). The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Mouse p19 cDNA encodes a 196 amino acid residue (aa) precursor protein with a putative 19 aa signal peptide and 177 aa mature protein. Human and mouse p19 share 70% aa sequence identity. Although p19 is expressed by activated macrophages, dendritic cells, T-cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. The functional IL-23 receptor complex consists of two receptor subunits, the IL-12 receptor beta 1 subunit (IL-12 R beta 1) and the IL-23-specific receptor subunit (IL-23 R). IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T-cells. While IL-12 acts on both naive and memory human Tnbsp;cells, the effects of IL-23 is restricted to memory Tcells. In mouse, IL-23 but not IL-12, has also been shown to induce memory T cells to secret IL-17, a potent proinflammatory cytokine. IL-12 and IL-23 can induce IL-12 production from mouse splenic DC of both the CD8- and CD8+ subtypes, however only IL-23 can act directly on CD8+ DC to mediate immunogenic presentation of poorly immunogenic tumor/self peptide.
Product Categories/Family for IL12B&IL23A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
UniProt Protein Name
Interleukin-12 subunit beta
UniProt Gene Name
Il12b
UniProt Synonym Gene Names
IL-12B; CLMF p40

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL12B&IL23A il12b (Catalog #AAA283405) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MWELEKDVYV VEVDWTPDAP GETVNLTCDT PEEDDITWTS DQRHGVIGSG KTLTITVKEF LDAGQYTCHK GGETLSHSHL LLHKKENGIW STEILKNFKN KTFLKCEAPN YSGRFTCSWL VQRNMDLKFN IKSSSSSPDS RAVTCGMASL SAEKVTLDQR DYEKYSVSCQ EDVTCPTAEE TLPIELALEA RQQNKYENYS TSFFIRDIIK PDPPKNLQMK PLKNSQVEVS WEYPDSWSTP HSYFSLKFFV RIQRKKEKMK ETEEGCNQKG AFLVEKTSTE VQCKGGNVCV QAQDRYYNSS CSKWACVPCR VRS&AVPRSS SPDWAQCQQL SRNLCMLAWN AHAPAGHMNL LREEEDEETK NNVPRIQCED GCDPQGLKDN SQFCLQRIRQ GLAFYKHLLD SDIFKGEPAL LPDSPMEQLH TSLLGLSQLL QPEDHPRETQ QMPSLSSSQQ WQRPLLRSKI LRSLQAFLAI AARVFAHGAA TLTEPLVPTA. It is sometimes possible for the material contained within the vial of "IL-23/IL-12B&IL-23A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.