IL-23/IL-12B&IL-23A Recombinant Protein | IL12B&IL23A recombinant protein

Recombinant Mouse IL-23/IL-12B&IL-23A Protein

Cat. Num. AAA283405

• Synonyms: IL-23/IL-12B&IL-23A; N/A; Recombinant Mouse IL-23/IL-12B&IL-23A Protein; p40; Il-12b; Il12p40; Il-12p40;IL12B;p19; IL-23;il23A; IL12B&IL23A recombinant protein

• Host: HEK293 cells
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&AVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

• Species: Mouse
• Tag: N-His(IL-23a) & No tag(IL-12b)
• Endotoxin: <0.1 EU/ug
• Bio-Activity: Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED₅₀ for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10⁶~3.44×10⁷ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL12B?IL23A induce IL-17 secretion by mouse splenocytes. The ED₅₀ for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10⁶~3.44×10⁷ units/mg.)

SDS-PAGE

(Recombinant Mouse IL-23/IL-12B&IL-23A Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25(IL-23A) ,45-50(IL-12B)kDa and 65-75 kDa, respectively.)

Related Product Information for IL12B&IL23A recombinant protein

Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12 (1-5). The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Mouse p19 cDNA encodes a 196 amino acid residue (aa) precursor protein with a putative 19 aa signal peptide and 177 aa mature protein. Human and mouse p19 share 70% aa sequence identity. Although p19 is expressed by activated macrophages, dendritic cells, T-cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. The functional IL-23 receptor complex consists of two receptor subunits, the IL-12 receptor beta 1 subunit (IL-12 R beta 1) and the IL-23-specific receptor subunit (IL-23 R). IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T-cells. While IL-12 acts on both naive and memory human Tnbsp;cells, the effects of IL-23 is restricted to memory Tcells. In mouse, IL-23 but not IL-12, has also been shown to induce memory T cells to secret IL-17, a potent proinflammatory cytokine. IL-12 and IL-23 can induce IL-12 production from mouse splenic DC of both the CD8- and CD8+ subtypes, however only IL-23 can act directly on CD8+ DC to mediate immunogenic presentation of poorly immunogenic tumor/self peptide.

Product Categories/Family for IL12B&IL23A recombinant protein

Interleukin; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1170461
• NCBI GeneID: 16160&83430
• UniProt Accession #: P43432; Q9EQ14
• UniProt Protein Name: Interleukin-12 subunit beta
• UniProt Gene Name: Il12b
• UniProt Synonym Gene Names: IL-12B; CLMF p40