Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Interleukin-18 Recombinant Protein | I18BP recombinant protein

Recombinant Human Interleukin-18-binding protein

Average rating 0.0
No ratings yet
Gene Names
IL18BP; IL18BPa
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Interleukin-18; N/A; Recombinant Human Interleukin-18-binding protein; Tadekinig-alfa; I18BP recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEAL
Immunogen Description
Expression Region:31-183aaSequence Info:Partial
Calculated MW
20.5 kDa
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Related Product Information for I18BP recombinant protein
Recombinant Protein

Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-18-binding protein isoform a
NCBI Official Synonym Full Names
interleukin 18 binding protein
NCBI Official Symbol
IL18BP
NCBI Official Synonym Symbols
IL18BPa
NCBI Protein Information
interleukin-18-binding protein
UniProt Protein Name
Interleukin-18-binding protein
UniProt Gene Name
IL18BP
UniProt Synonym Gene Names
IL-18BP

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The I18BP il18bp (Catalog #AAA309770) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Recombinant Human Interleukin-18-binding protein reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: TPVSQTTTAA TASVRSTKDP CPSQPPVFPA AKQCPALEVT WPEVEVPLNG TLSLSCVACS RFPNFSILYW LGNGSFIEHL PGRLWEGSTS RERGSTGTQL CKALVLEQLT PALHSTNFSC VLVDPEQVVQ RHVVLAQLWA GLRATLPPTQ EAL. It is sometimes possible for the material contained within the vial of "Interleukin-18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.