Application Data
(Recombinant Rat IL-1 beta Protein stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED<sub>50</sub> for this effect is 0.68-2.72 ng/mL, corresponding to a specific activity of 3.68×10<sup>5</sup>~1.47×10<sup>6</sup> units/mg.)
IL-1 beta Recombinant Protein | IL-1beta recombinant protein
Recombinant Rat IL-1 beta Protein
Purity
>85% by SDS-PAGE.
Synonyms
IL-1 beta; N/A; Recombinant Rat IL-1 beta Protein; IL-1F2;IL-1 beta, IL1B, IL-1BETA, IL1F2, IL-1beta, il1b, IL1B; IL-1beta recombinant protein
Host
HEK293 cells
Purity/Purification
>85% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Species
Rat
Tag
C-His
Endotoxin
<1EU/ug
Bio-Activity
Recombinant Rat IL-1 beta Protein stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is 0.68-2.72ng/mL, corresponding to a specific activity of 3.68×105~1.47×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Rat IL-1 beta Protein stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED<sub>50</sub> for this effect is 0.68-2.72 ng/mL, corresponding to a specific activity of 3.68×10<sup>5</sup>~1.47×10<sup>6</sup> units/mg.)
Application Data
(Recombinant Rat IL-1 beta Protein stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED<sub>50</sub> for this effect is 0.68-2.72 ng/mL, corresponding to a specific activity of 3.68×10<sup>5</sup>~1.47×10<sup>6</sup> units/mg.)
SDS-PAGE
(Recombinant Rat IL-1 beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18-25 kDa.)
SDS-PAGE
(Recombinant Rat IL-1 beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18-25 kDa.)
Related Product Information for IL-1beta recombinant protein
Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
Product Categories/Family for IL-1beta recombinant protein
NCBI and Uniprot Product Information
Similar Products
Product Notes
The IL-1beta il1b (Catalog #AAA283375) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VPIRQLHCRL RDEQQKCLVL SDPCELKALH LNGQNISQQV VFSMSFVQGE TSNDKIPVAL GLKGKNLYLS CVMKDGTPTL QLESVDPKQY PKKKMEKRFV FNKIEVKTKV EFESAQFPNW YISTSQAEHR PVFLGNSNGR DIVDFTMEPV SS. It is sometimes possible for the material contained within the vial of "IL-1 beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.