Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283367_AD13.jpg Application Data (Recombinant Rat IL-3 stimulates cell proliferation of the NFS_x005f60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 2.6?10.6 ng/mL,corresponding to a specific activity of 9.4×10<sup>4</sup>~3.85×10<sup>5</sup> units/mg.)

IL-3 Recombinant Protein | IL3 recombinant protein

Recombinant Rat IL-3 Protein

Average rating 0.0
No ratings yet
Purity
>97% by SDS-PAGE.
Synonyms
IL-3; N/A; Recombinant Rat IL-3 Protein; IL-3;IL3; IL3 recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Species
Rat
Tag
C-His
Endotoxin
<0.1EU/ug
Bio-Activity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 2.6?10.6ng/mL, corresponding to a specific activity of 9.4×104~3.85×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Rat IL-3 stimulates cell proliferation of the NFS_x005f60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 2.6?10.6 ng/mL,corresponding to a specific activity of 9.4×10<sup>4</sup>~3.85×10<sup>5</sup> units/mg.)

product-image-AAA283367_AD13.jpg Application Data (Recombinant Rat IL-3 stimulates cell proliferation of the NFS_x005f60 mouse myelogenous leukemia lymphoblast cells. The ED<sub>50</sub> for this effect is 2.6?10.6 ng/mL,corresponding to a specific activity of 9.4×10<sup>4</sup>~3.85×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Rat IL-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)

product-image-AAA283367_SDS_PAGE15.jpg SDS-PAGE (Recombinant Rat IL-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)
Related Product Information for IL3 recombinant protein
IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
Product Categories/Family for IL3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interleukin-3
UniProt Gene Name
Il3
UniProt Synonym Gene Names
IL-3
UniProt Entry Name
P97688_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL3 il3 (Catalog #AAA283367) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ISDRGSDAHH LLRTLDCRTI ALEILVKLPY PQVSGLNNSD DKANLRNSTL RRVNLDEFLK SQEEFDSQDT TDIKSKLQKL KCCIPAAASD SVLPGVYNKD LDDFKKKLRF YVIHLKDLQP VSVSRPPQPT SSSDNFRPMT VEC. It is sometimes possible for the material contained within the vial of "IL-3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.