Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14949_ELISA2.jpg ELISA (Fig 2: Binding of VEGF-A isoforms to recombinant human soluble Neuropilin-1 receptor (NRP-1) in a functional ELISA. NRP-1 was coated with 1ug/ml (100ul/well), the ligands were added with 10ng/ml.)

NRP-1, soluble Active Protein | NRP-1 active protein

Recombinant Human Soluble Neuropilin-1

Gene Names
NRP1; NP1; NRP; BDCA4; CD304; VEGF165R
Purity
>98% by SDS-PAGE & Coomassie stain
Synonyms
NRP-1, soluble; N/A; Recombinant Human Soluble Neuropilin-1; Vascular endothelial growth factor 165 receptor,CD304, VEGF165R, NRP; NRP-1 active protein
Ordering
Host
Insect cells
Purity/Purification
>98% by SDS-PAGE & Coomassie stain
Form/Format
Lyophilized; PBS
Sequence
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINF NPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFI KFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSL ECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVG PHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSE DFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDS YREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWIT IKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEV YGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGW ALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSN NGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATH GGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLT GGTTVLATEKPTVIDSTIQSGIKLEHHHHHH
Sequence Length
644
Result by N-Terminal Sequencing
FRNDKCGDTI
Protein RefSeq
NP_003864.4
mRNA RefSeq
NM_003873.5
Stabilizer
None
Length (aa)
631
Reconstitution
The lyophilized human sNRP-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100ug/ml.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized soluble Neuropilin-1 binds all VEGF-A isoforms with the exception of VEGF121.
Preparation and Storage
The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquot the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days.

ELISA

(Fig 2: Binding of VEGF-A isoforms to recombinant human soluble Neuropilin-1 receptor (NRP-1) in a functional ELISA. NRP-1 was coated with 1ug/ml (100ul/well), the ligands were added with 10ng/ml.)

product-image-AAA14949_ELISA2.jpg ELISA (Fig 2: Binding of VEGF-A isoforms to recombinant human soluble Neuropilin-1 receptor (NRP-1) in a functional ELISA. NRP-1 was coated with 1ug/ml (100ul/well), the ligands were added with 10ng/ml.)

SDS-PAGE

(Fig:1 SDS-PAGE analysis of recombinant human soluble NRP-1. Sample was loaded in 10% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.)

product-image-AAA14949_SDS_PAGE.jpg SDS-PAGE (Fig:1 SDS-PAGE analysis of recombinant human soluble NRP-1. Sample was loaded in 10% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.)
Related Product Information for NRP-1 active protein
Neuropilin-1 (NRP-1, CD304) is a 130-140 kDa type I transmembrane glycoprotein that regulates axon guidance and angiogenesis. The human NRP-1 contains a 623 aa extracellular domain (ECD) that shows 92-95% aa identity with mouse, rat, bovine and canine NRP-1. The ECD contains two N-terminal CUB domains (termed a1a2), two domains with homology to coagulation factors V and VIII (b1b2) and a MAM (meprin) domain. C-terminally divergent splice variants with 704, 644, 609, and 551 aa lack the MAM and TM domains and are demonstrated or presumed to be soluble antagonists. Heparin, the heparin-binding forms of VEGF (VEGF165, VEGF-B; VEGF-E), PlGF-2, and the C-terminus of Sema3 bind the b1b2 region. NRP-1 and NRP-2 share 48% aa identity within the ECD and can form homo and hetero-oligomers via interaction of their MAM domains. Neuropilins show partially overlapping expression in neuronal and endothelial cells during development. Both neuropilins act as coreceptors with Plexins, mainly Plexin A3 and A4, to bind class III Semaphorins that mediate axon repulsion. However, only NRP-1 binds Sema3A, and only NRP-2 binds Sema 3F. Both are co-receptors with VEGFR-2 (KDR7Flk1) for VEGF165 binding. Sema 3A signaling can be blocked by VEGF165, which has higher affinity for NRP-1. NRP-1 is preferentially expressed in arteries during development or those undergoing remodeling. NRP-1 is also expressed on dendritic cells and mediates DC-induced T-cell proliferation.
Product Categories/Family for NRP-1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,6 kDa
NCBI Official Full Name
neuropilin-1 isoform b
NCBI Official Synonym Full Names
neuropilin 1
NCBI Official Symbol
NRP1
NCBI Official Synonym Symbols
NP1; NRP; BDCA4; CD304; VEGF165R
NCBI Protein Information
neuropilin-1; transmembrane receptor; vascular endothelial cell growth factor 165 receptor
UniProt Protein Name
Neuropilin-1
UniProt Gene Name
NRP1
UniProt Synonym Gene Names
NRP; VEGF165R
UniProt Entry Name
NRP1_HUMAN

Similar Products

Product Notes

The NRP-1 nrp1 (Catalog #AAA14949) is an Active Protein produced from Insect cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FRNDKCGDTI KIESPGYLTS PGYPHSYHPS EKCEWLIQAP DPYQRIMINF NPHFDLEDRD CKYDYVEVFD GENENGHFRG KFCGKIAPPP VVSSGPFLFI KFVSDYETHG AGFSIRYEIF KRGPECSQNY TTPSGVIKSP GFPEKYPNSL ECTYIVFAPK MSEIILEFES FDLEPDSNPP GGMFCRYDRL EIWDGFPDVG PHIGRYCGQK TPGRIRSSSG ILSMVFYTDS AIAKEGFSAN YSVLQSSVSE DFKCMEALGM ESGEIHSDQI TASSQYSTNW SAERSRLNYP ENGWTPGEDS YREWIQVDLG LLRFVTAVGT QGAISKETKK KYYVKTYKID VSSNGEDWIT IKEGNKPVLF QGNTNPTDVV VAVFPKPLIT RFVRIKPATW ETGISMRFEV YGCKITDYPC SGMLGMVSGL ISDSQITSSN QGDRNWMPEN IRLVTSRSGW ALPPAPHSYI NEWLQIDLGE EKIVRGIIIQ GGKHRENKVF MRKFKIGYSN NGSDWKMIMD DSKRKAKSFE GNNNYDTPEL RTFPALSTRF IRIYPERATH GGLGLRMELL GCEVEAPTAG PTTPNGNLVD ECDDDQANCH SGTGDDFQLT GGTTVLATEK PTVIDSTIQS GIKLEHHHHH H. It is sometimes possible for the material contained within the vial of "NRP-1, soluble, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.