NRP-1, soluble Active Protein | NRP-1 active protein

Recombinant Human Soluble Neuropilin-1

Cat. Num. AAA14949

• Gene Names: NRP1; NP1; NRP; BDCA4; CD304; VEGF165R
• Purity: >98% by SDS-PAGE & Coomassie stain
• Synonyms: NRP-1, soluble; N/A; Recombinant Human Soluble Neuropilin-1; Vascular endothelial growth factor 165 receptor,CD304, VEGF165R, NRP; NRP-1 active protein

• Host: Insect cells
• Purity/Purification: >98% by SDS-PAGE & Coomassie stain
• Form/Format: Lyophilized; PBS
• Sequence: FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINF NPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFI KFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSL ECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVG PHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSE DFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDS YREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWIT IKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEV YGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGW ALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSN NGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATH GGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLT GGTTVLATEKPTVIDSTIQSGIKLEHHHHHH
• Sequence Length: 644

• Result by N-Terminal Sequencing: FRNDKCGDTI
• Protein RefSeq: NP_003864.4
• mRNA RefSeq: NM_003873.5
• Stabilizer: None
• Length (aa): 631
• Reconstitution: The lyophilized human sNRP-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100ug/ml.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized soluble Neuropilin-1 binds all VEGF-A isoforms with the exception of VEGF₁₂₁.
• Preparation and Storage: The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquot the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days.

ELISA

(Fig 2: Binding of VEGF-A isoforms to recombinant human soluble Neuropilin-1 receptor (NRP-1) in a functional ELISA. NRP-1 was coated with 1ug/ml (100ul/well), the ligands were added with 10ng/ml.)

SDS-PAGE

(Fig:1 SDS-PAGE analysis of recombinant human soluble NRP-1. Sample was loaded in 10% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.)

Related Product Information for NRP-1 active protein

Neuropilin-1 (NRP-1, CD304) is a 130-140 kDa type I transmembrane glycoprotein that regulates axon guidance and angiogenesis. The human NRP-1 contains a 623 aa extracellular domain (ECD) that shows 92-95% aa identity with mouse, rat, bovine and canine NRP-1. The ECD contains two N-terminal CUB domains (termed a1a2), two domains with homology to coagulation factors V and VIII (b1b2) and a MAM (meprin) domain. C-terminally divergent splice variants with 704, 644, 609, and 551 aa lack the MAM and TM domains and are demonstrated or presumed to be soluble antagonists. Heparin, the heparin-binding forms of VEGF (VEGF165, VEGF-B; VEGF-E), PlGF-2, and the C-terminus of Sema3 bind the b1b2 region. NRP-1 and NRP-2 share 48% aa identity within the ECD and can form homo and hetero-oligomers via interaction of their MAM domains. Neuropilins show partially overlapping expression in neuronal and endothelial cells during development. Both neuropilins act as coreceptors with Plexins, mainly Plexin A3 and A4, to bind class III Semaphorins that mediate axon repulsion. However, only NRP-1 binds Sema3A, and only NRP-2 binds Sema 3F. Both are co-receptors with VEGFR-2 (KDR7Flk1) for VEGF165 binding. Sema 3A signaling can be blocked by VEGF165, which has higher affinity for NRP-1. NRP-1 is preferentially expressed in arteries during development or those undergoing remodeling. NRP-1 is also expressed on dendritic cells and mediates DC-induced T-cell proliferation.

Product Categories/Family for NRP-1 active protein

Soluble receptors

NCBI and Uniprot Product Information

• NCBI GI #: 66912178
• NCBI GeneID: 8829
• NCBI Accession #: NP_001019799.1
• NCBI GenBank Nucleotide #: NM_001024628.2
• UniProt Accession #: O14786; O60461; Q5T7F1; Q5T7F2; Q5T7F3; Q86T59; Q96I90; Q96IH5; B0LPG9
• Molecular Weight: 82,6 kDa
• NCBI Official Full Name: neuropilin-1 isoform b
• NCBI Official Synonym Full Names: neuropilin 1
• NCBI Official Symbol: NRP1
• NCBI Official Synonym Symbols: NP1; NRP; BDCA4; CD304; VEGF165R
• NCBI Protein Information: neuropilin-1; transmembrane receptor; vascular endothelial cell growth factor 165 receptor
• UniProt Protein Name: Neuropilin-1
• UniProt Gene Name: NRP1
• UniProt Synonym Gene Names: NRP; VEGF165R
• UniProt Entry Name: NRP1_HUMAN