Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79169_AD13.jpg Application Data (BMP-2 BioLISA using recombinant human soluble BMPR-IA for capturing and recombinant human BMP-2 as standard. A rabbit anti-human BMP-2 antibody in combination with an goat anti-rabbit Biotin antibody was used for detection.)

BMP receptor-1A, soluble Active Protein | BMP receptor-1A active protein

Human BMP receptor-1A, soluble

Gene Names
BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del
Reactivity
Human
Purity
> 90% by SDS-PAGE & silver stain
Synonyms
BMP receptor-1A, soluble; N/A; Human BMP receptor-1A, soluble; Recombinant Human Soluble BMP Receptor Type-1A; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292; BMP receptor-1A active protein
Ordering
Host
Insect Cells
Reactivity
Human
Purity/Purification
> 90% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAIN NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
Sequence Length
135
Buffer
PBS
Reconstitution
The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml.
Biological Activity
Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED50 for this effect is typically 1-4 ug/ml in the presence of 500ng/ml of recombinant human BMP-2.
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sBMPR-1A should be stored in working aliquots at -20 degree C.

Application Data

(BMP-2 BioLISA using recombinant human soluble BMPR-IA for capturing and recombinant human BMP-2 as standard. A rabbit anti-human BMP-2 antibody in combination with an goat anti-rabbit Biotin antibody was used for detection.)

product-image-AAA79169_AD13.jpg Application Data (BMP-2 BioLISA using recombinant human soluble BMPR-IA for capturing and recombinant human BMP-2 as standard. A rabbit anti-human BMP-2 antibody in combination with an goat anti-rabbit Biotin antibody was used for detection.)

Application Data

product-image-AAA79169_AD15.jpg Application Data
Related Product Information for BMP receptor-1A active protein
The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity.
Product Categories/Family for BMP receptor-1A active protein
References
1. Wu MY and CS Hill Dev Cell 16:329, 2009 2. Nickel J et al, Cytokine Growth Factor Rev 20:367, 2009 3. de Caestecker M, Cytokine Growth Factor Rev 15:1, 2004 4. Schmal H et al, Cytotherapy 14(7):868-76, 2012 5. Liu R etal, BMC Musculoskelet Disord 15;10:51, 2009

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
657
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa (Monomer)
NCBI Official Full Name
bone morphogenetic protein receptor type-1A
NCBI Official Synonym Full Names
bone morphogenetic protein receptor, type IA
NCBI Official Symbol
BMPR1A
NCBI Official Synonym Symbols
ALK3; SKR5; CD292; ACVRLK3; 10q23del
NCBI Protein Information
bone morphogenetic protein receptor type-1A; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5
UniProt Protein Name
Bone morphogenetic protein receptor type-1A
UniProt Gene Name
BMPR1A
UniProt Synonym Gene Names
ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
UniProt Entry Name
BMR1A_HUMAN

Similar Products

Product Notes

The BMP receptor-1A bmpr1a (Catalog #AAA79169) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Human BMP receptor-1A, soluble reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: QNLDSMLHGT GMKSDSDQKK SENGVTLAPE DTLPFLKCYC SGHCPDDAIN NTCITNGHCF AIIEEDDQGE TTLASGCMKY EGSDFQCKDS PKAQLRRTIE CCRTNLCNQY LQPTLPPVVI GPFFDGSIRH HHHHH. It is sometimes possible for the material contained within the vial of "BMP receptor-1A, soluble, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.