BMP receptor-1A, soluble Active Protein | BMP receptor-1A active protein

Human BMP receptor-1A, soluble

Cat. Num. AAA79169

• Gene Names: BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del
• Reactivity: Human
• Purity: > 90% by SDS-PAGE & silver stain
• Synonyms: BMP receptor-1A, soluble; N/A; Human BMP receptor-1A, soluble; Recombinant Human Soluble BMP Receptor Type-1A; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292; BMP receptor-1A active protein

• Host: Insect Cells
• Reactivity: Human
• Purity/Purification: > 90% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAIN NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
• Sequence Length: 135

• Buffer: PBS
• Reconstitution: The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml.
• Biological Activity: Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED₅₀ for this effect is typically 1-4 ug/ml in the presence of 500ng/ml of recombinant human BMP-2.
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sBMPR-1A should be stored in working aliquots at -20 degree C.

Application Data

(BMP-2 BioLISA using recombinant human soluble BMPR-IA for capturing and recombinant human BMP-2 as standard. A rabbit anti-human BMP-2 antibody in combination with an goat anti-rabbit Biotin antibody was used for detection.)

Application Data

Related Product Information for BMP receptor-1A active protein

The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity.

Product Categories/Family for BMP receptor-1A active protein

Soluble receptors

References

1. Wu MY and CS Hill Dev Cell 16:329, 2009 2. Nickel J et al, Cytokine Growth Factor Rev 20:367, 2009 3. de Caestecker M, Cytokine Growth Factor Rev 15:1, 2004 4. Schmal H et al, Cytotherapy 14(7):868-76, 2012 5. Liu R etal, BMC Musculoskelet Disord 15;10:51, 2009

NCBI and Uniprot Product Information

• NCBI GI #: 41349437
• NCBI GeneID: 657
• NCBI Accession #: NP_033888
• NCBI GenBank Nucleotide #: NM_009758
• UniProt Accession #: P36894; Q8NEN8; A8K6U9
• Molecular Weight: 23 kDa (Monomer)
• NCBI Official Full Name: bone morphogenetic protein receptor type-1A
• NCBI Official Synonym Full Names: bone morphogenetic protein receptor, type IA
• NCBI Official Symbol: BMPR1A
• NCBI Official Synonym Symbols: ALK3; SKR5; CD292; ACVRLK3; 10q23del
• NCBI Protein Information: bone morphogenetic protein receptor type-1A; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5
• UniProt Protein Name: Bone morphogenetic protein receptor type-1A
• UniProt Gene Name: BMPR1A
• UniProt Synonym Gene Names: ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
• UniProt Entry Name: BMR1A_HUMAN